KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBG1620Help
Entry
CNBG1620          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K02358  
elongation factor Tu
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Brite
Translation factors [BR:cnb03012]
 Eukaryotic Type
  Elongation factors
   CNBG1620
 Prokaryotic Type
   CNBG1620
Mitochondrial biogenesis [BR:cnb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CNBG1620
Exosome [BR:cnb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CNBG1620
  Exosomal proteins of breast cancer cells
   CNBG1620
  Exosomal proteins of colorectal cancer cells
   CNBG1620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
7
AA seq 464 aa AA seqDB search
MLRNALQSRLSSTLRTAELRAARPVAGPSVLAARTFVSKPLPSPRFRAAVLTPRRLPTRS
YAAEAGGKFTRSKPHFNIGTIGHVDHGKTTLTAAITKHLAEQGGGKFMDYSQIDKAPEEK
ARGITISTAHVEYETPNRHYAHIDCPGHADYIKNMITGAAQLDGAIIVVSATDGQMPQTR
EHLLLARQVGIKKLVVFINKVDQVDDPEMLELVEMEMRELLGQYGFDGEETPIVMGSALA
ALEGRDPERGAQKIQELMEKADEWLDVPSRDLDKPFLMYVEDVFSISGRGTVVTGKVERG
TITKGSEVEIVGLGAPVKTILTGIEMFHKELERGEAGDNMGALLRGIKREQVRRGQVLVQ
PGSIKSVKKFKAQIYILTKEEGGRYTPFMANYRPQLFIRTTDVTCALTFPEGTEGAHEKL
VMPGDNVEMIGDLVHDIALEPGSRFTLREGGKTIGTGIVSEIYE
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgctcagaaacgcccttcagagtcgcctttcctccactctccgaaccgctgagcttagg
gctgccaggcccgtggctggtccctcggtcctcgctgccaggacattcgtctcaaagccc
cttccctctcctcgttttcgagctgctgttttgacgccaagacgtctacctactcgtagc
tacgctgccgaagctggtggtaaattcactagatccaaacctcatttcaacatcggtacc
atcggccatgttgaccatggtaaaaccacccttaccgccgccatcactaagcatttggcc
gagcagggtggcggtaagtttatggactacagccagatcgacaaagctcctgaggagaaa
gctcgaggtatcaccattagcactgcccatgtcgaatacgagacccccaacaggcactat
gcgcatatcgactgtcctggtcatgccgattacatcaaaaacatgattaccggtgccgct
caacttgacggtgctattattgtcgtctctgctactgatggtcaaatgcctcagacccgt
gagcatcttcttcttgcccgtcaagttggcatcaagaagttggttgtctttatcaacaag
gtcgaccaggtggatgaccccgaaatgctcgagttggttgagatggaaatgagagaattg
ctaggccagtacggtttcgatggagaggagactcctatcgtcatgggatccgctcttgct
gctctcgaaggccgcgaccctgagcgaggcgcgcaaaagattcaggagctcatggagaag
gctgatgaatggcttgacgtcccctctcgggacctcgacaagcctttcttgatgtatgtt
gaggacgtattctctatctctggccgaggcaccgttgttaccgggaaagttgagcgtggt
acaatcaccaagggttccgaagtcgaaatcgttggcctcggtgcgcctgtcaaaactatt
ctcactggcattgaaatgttccacaaggagcttgaacgtggtgaagctggtgacaacatg
ggtgcccttcttcgtggtatcaaacgagagcaggtccgacgaggtcaagttttggtacaa
cctggctctatcaagagtgttaagaagttcaaggcgcaaatttatatccttaccaaggag
gaaggtggtcgttacacccctttcatggctaactaccgacctcagctcttcatccgtact
accgacgtaacttgtgccctcactttcccagagggtaccgagggcgctcatgagaagctc
gtcatgcctggtgacaatgttgagatgattggtgaccttgtgcatgacatcgcccttgag
cccggatcgcgttttacattgcgagaaggcggtaagactattggcactggtattgtttca
gagatctatgaataa

DBGET integrated database retrieval system