KEGG   Cupriavidus necator N-1: CNE_2c05160Help
Entry
CNE_2c05160       CDS       T01564                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
cnc  Cupriavidus necator N-1
Brite
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     CNE_2c05160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:550227..550982
Genome map
AA seq 251 aa AA seqDB search
MSGAFLRSAQAPEPGASVPDLSAFPITRKWPAQHPDRIQLYSLPTPNGVKVSIMLEETGL
PYEPHLVRFDAHDQMSPEFLSLSPNNKIPAILDPNGPRGKPLALFESGAILLYLADKSGK
RIPADPARRYETIQWVMFQMGGIGPMFGQVGFFHKFAGKEYEDKRPRDRYVAESRRLLNV
LNQRLEGRDWIMGDEYTIADIATFPWVRNLVGFYEAGELVGIQDVPHVRRVLEAFVKRPA
VVKGLDTPHRG
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcgccttcttgcgcagtgcgcaagcgcctgaaccaggagccagtgtgcccgat
ctgtccgctttccccatcacccgcaaatggccggcgcagcatcccgaccgcatccagctg
tattccctgcccacgcccaacggggtcaaggtgtcgatcatgctggaggagaccggcctg
ccgtatgaaccgcacctggtacgcttcgacgcccacgaccagatgtcgccggagttcctg
tcgctgagcccgaacaacaagattcccgccatcctcgatcccaacggcccgcgcggcaag
ccgctggcgctgttcgagtcgggcgcgatcctgctctacctggccgacaagtcgggcaag
cggatcccggccgaccccgcgcgccgctacgaaaccatccagtgggtgatgttccagatg
ggcggcatcgggccgatgttcgggcaggtgggctttttccacaagttcgccggcaaggag
tacgaggacaagcgcccgcgcgaccgctacgtggccgaaagccggcgcctgctgaatgtg
ctgaaccagcggctggaagggcgcgactggatcatgggtgacgaatacaccatcgccgac
atcgccacctttccgtgggtgcgcaacctggttggcttctatgaggcgggcgaactggtc
ggcatccaggacgtcccgcatgtcaggcgcgtgctggaggcgttcgtcaagcgcccggcc
gtggtgaaggggctcgatacgccgcaccgcggctga

DBGET integrated database retrieval system