KEGG   Cupriavidus necator N-1: CNE_2c20580Help
Entry
CNE_2c20580       CDS       T01564                                 

Gene name
fadD
Definition
(GenBank) long-chain-fatty-acid--CoA ligase FadD
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:2217198..2220044
Genome map
AA seq 948 aa AA seqDB search
MKADSPPRQNYEDALLGIVREMSSAMRPPAESEVTVALDSTLEGELGFDSLTRAELLTRL
EHRFGVSLPEQVLAQADTPRALLRALLAAQDLPPGASGAHLRQARPAPAAQAPEGAATLP
DVLRWHLRSHPERTHIILQDGDGADTQISFAQLHRRAAAIAAGLVARGVSAGTAVAIMLP
TSPEYFYSFCGVLLAGGIPVPLYPPARLAQIGDHLQRHAGILANAQAPILITVAQARPLA
ALLKASTGTLHSVLTPQELEDGGGAPVHPMLRTHDIALLQYTSGSTGSPKGVVLSHANLL
ANLRAMGKTLAVGSQDVFVSWLPLYHDMGLIGAWLGSLYYAYPLVVMSPLAFLARPERWL
WAIHKYRGTLSGGPNFAFELCLRKLANADLAGLDLSSWRFVFNGAEPVSLQTMRAFMERF
ARYGLHPQAAAPVYGLAEASLGLTFPPLGRGLAADRIDRAEFTRTAVAVPAGEREPNGER
KTLEFPSCGRPLSGHEVRIVDATGCELGERHEGLLQFRGPSATSGYFRNPVQTRQLFDRG
WLNTGDYAYIAADEVYITGRAKETIVRGGRNIYPYELEQAVGAIPGIRKGCVAVFGSPDP
ESGTERIVVMAETAEKDVQARRALHRQALKTALDVLGMPPDHIALVPPHSILKTSSGKIR
RAACRERFEHGRPGRGVEAPWLQIARFGWRALRPELRRGRQTAAGLSYALYAWLLFAALA
PATWLASVALHRPALGWALSHHAARLFLRLGAVPWFVQGLEHLPRDRPCILVSNHASYLD
GIVLVAALPAPVCMVAKRELQGQRIPGTYLASIGADFIDRFDNVREHEDVERVVAAVRAG
HSALFFPEGTFGRAPGLQAFRSGAFLAAARAGAPVVPVAIRGTRSVLRDGQWLPRRGPIG
VVFGSPLWPDGADWPAAMRLRNTARAEILHYCGEPDARRTTHRDGRRA
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggattctcccccgaggcagaactacgaggatgccctgctcggcatcgtgcgg
gagatgtcttcggccatgcgcccgccggcagagtctgaagtgacggtcgcgctggacagc
acgctcgaaggcgaactgggctttgacagcctgacgcgcgccgagctgctgacccgcctt
gaacaccgcttcggcgtcagcctgccagagcaggtgctggcccaggccgacaccccgcgc
gcgctgctgcgtgccttgctcgccgcccaggacctcccgcctggcgcaagcggcgcgcac
ctgcgccaggcccgccctgccccggcggcgcaggcgcccgagggcgccgccaccttgccg
gacgtgctgcgctggcacttgcgcagccacccggagcgcacccacatcatcctgcaggac
ggcgacggcgcagacacgcagatcagctttgcgcagctgcaccgccgcgccgcggccatc
gccgccggactggtcgcccgcggcgtgagcgcgggcacggccgtggccatcatgctgccc
accagccccgagtacttctacagcttctgcggcgtgctgctggcgggcgggattccggta
ccgctctacccgccggcgcggctggcgcagatcggcgaccacctgcagcgccacgccggc
atcctggccaacgcgcaggcgccgatcctgatcacggtggcccaggcgcggccgctggcg
gccctgctcaaggccagcacgggaacgctgcatagcgtgctcacgccgcaggaactggag
gacggcggcggcgccccggtccatccgatgctgcgcacgcacgacatcgccctgctgcaa
tacacctcgggcagcaccggctcgcccaagggggtcgtgctcagccatgccaacctgctg
gccaacctgcgcgccatgggcaagacccttgccgtcggctcgcaggacgtctttgtcagc
tggctgccgctctatcacgacatgggcctgatcggcgcctggctgggcagcctgtactac
gcctacccgctggtggtgatgtcaccgcttgccttcctggcgcggcccgagcgctggctc
tgggcgatccacaagtaccgcggcacgctctcgggcgggcccaactttgccttcgagctg
tgcctgcgcaagctggccaatgccgacctggccggcctggacctttccagctggcgcttc
gtcttcaatggcgcggagccggtgagcctgcagaccatgcgcgccttcatggagcgcttt
gcccgctacggcctgcacccgcaggccgccgcgcctgtgtacgggctggccgaggcctcg
ctgggcctgacctttccgccgctgggccgcgggctggccgccgaccgcatcgaccgcgcc
gagttcacgcgcactgccgtggccgtgcccgccggcgaacgcgagcccaatggtgagcgc
aagaccctggaattcccgtcctgcggccggccgctgtccggccacgaagtccgcatcgtc
gacgccaccggatgcgaactgggtgagcggcatgagggcctgctgcagttccgcggccct
tcggccaccagcggctatttccgcaatcccgtgcagacccgccagctgttcgaccgcggc
tggctgaacaccggcgactatgcctatatcgccgccgatgaggtctatatcaccgggcgc
gccaaggaaaccatcgtgcgcggcggccgcaatatctatccctatgaactggagcaggcg
gtcggcgccatccccggcatacgcaagggctgcgtggccgtgttcggcagtcccgatccg
gagagcggcaccgaacgcatcgtggtgatggcggaaaccgccgagaaggatgtgcaggcg
cgccgcgcgctgcaccggcaggcgctgaagaccgccctcgacgtgctgggcatgccgccc
gaccatatcgcgctggtgccgccgcacagcatcctgaagacatcgagcggcaagatccgg
cgcgccgcctgccgcgagcgcttcgagcacggacggcccggccgtggcgtggaggcgccc
tggctgcagatcgcgcgctttggctggcgcgcgctgcggccggagctgcggcgcggccgg
cagaccgccgcgggcctgtcctacgccctctatgcctggctcctgttcgccgcgctggcg
ccggcaacctggctggcatcggttgcactgcaccggccggcactgggctgggcgctcagc
caccacgctgcccggctgtttctcaggctgggcgcggtgccatggttcgtgcaagggctt
gagcacctgccgcgcgaccggccctgcatcctggtctcgaaccacgccagctacctggat
ggcatcgtgctggtggcggcgctgcccgcgccggtatgcatggtcgccaagcgcgagctg
cagggccagcgcattcccggcacctacctggccagcatcggcgccgatttcatcgaccgc
ttcgataacgtgcgcgaacacgaggacgtggagcgcgtagtggcggcggtgcgcgccggg
cattcggcgctgttcttccccgaaggcaccttcgggcgcgccccggggcttcaggccttc
cgctcgggcgcgttcctggcggccgcgcgggccggcgcgccggtggtgccggtcgccatc
cgcggcacccgctcggtgctgcgcgacggccagtggctgccgcgccgggggccgatcggc
gtggtattcggcagcccgctctggccggacggcgcagactggccggccgccatgcgcctg
cgcaacaccgcccgcgccgagatcctgcattactgcggcgagccggacgcccggcgcacg
acgcaccgggatggaaggcgggcctag

DBGET integrated database retrieval system