KEGG   Cryptococcus neoformans var. neoformans JEC21: CND01490Help
Entry
CND01490          CDS       T00243                                 

Definition
(RefSeq) copper zinc superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cne00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    CND01490
Enzymes [BR:cne01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CND01490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 3256867
NCBI-ProteinID: XP_570285
UniProt: Q5KIW7
LinkDB All DBs
Position
4:complement(join(416779..416794,416847..416991,417042..417089,417144..417297,417359..417451,417690..417698))
Genome map
AA seq 154 aa AA seqDB search
MVKAVAVLKGDSHVYGTITFTQDSEGAPVCVSGEIKNLDADAKRGFHVHEFGDNTNGCTS
AGPHYNPFHKNHGGPTAAERHVGDLGNVQTNGCGVAMVDISDKVISLFGPHSIIGRSMVV
HAGTDDLGKGGNEESLKTGNAGARLACGVIGIAA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggctgttgctgtcctcaagggtgactcccacgtctacggtactataactttt
acccaggactcggaaggcgctcccgtttgcgtctcgggtgagatcaagaacctcgacgct
gacgccaagcgaggcttccacgtccacgagtttggagacaacaccaacggctgtacttct
gccggtccccattacaaccccttccacaagaaccacggtggtcccactgccgccgagagg
cacgttggtgacctcggtaacgtccaaacgaacggctgcggtgtcgctatggttgacatt
tccgacaaggtcatctccctcttcggccctcactccatcattggtcgaagtatggtcgtc
cacgccggtactgacgatctcggcaagggcggcaacgaggagtccctgaagactggcaat
gcaggtgcccgtcttgcctgcggtgtcatcggtatcgccgcttaa

DBGET integrated database retrieval system