KEGG   Cryptococcus neoformans var. neoformans JEC21: CNJ00590Help
Entry
CNJ00590          CDS       T00243                                 

Definition
(RefSeq) glycogen (starch) synthase
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CNJ00590
Enzymes [BR:cne01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CNJ00590
Glycosyltransferases [BR:cne01003]
 Polysaccharide
  Storage polysaccharide
   CNJ00590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
10:join(167519..167643,167699..167761,167816..167944,167998..168115,168169..168496,168546..168764,168813..169313,169366..169478,169538..169925,169985..170202)
Genome map
AA seq 733 aa AA seqDB search
MPRSVHNPFLFEAAWEVANKVGGIYTVIKTKVPVTVREYGDRLCLIGPLSYKSAPVEVEA
EEPGPGPFGDALRSMQERGVKLLYGRWLIEGAPRVLLFDTGSCYDRMDEWKGDLWNLAGI
PSPPNDHETNETIVFGYMVAWFLGEFAARETDNAIVAHFHEWQAGLAIPLCRKRHIDVTT
IFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCIERSSAHCADVFTTVSH
ITAFESEHLLKRKPDGVLPNGLNVVKFAAMHEFQNLHVQSKEKINEFIRGHFYGHYDFDL
DNTIYMFTAGRYEFRNKGVDMFIESLARLNHRLKKMGSKTTVVAFIIMPAATNSYTIEAL
KGQAVTSQLKDCVEQVTNRISKRIFEHACRYSGEHGTEVPNPEDLLSNEDRVLLKRRVFA
LKRNSLPPIVTHNMADDANDPILNQLRRVQLFNRPEDRVKVIFHPEFLNSNNPILGLDYE
EFVRGCHLGVFPSYYEPFGYTPAECTVMGIPNITTNLSGFGCFMEDLLESPEDYGCYIVD
RRGQGIEESVDQLTGQLLSFTTKSRRQRINQRNRTERLSELLDWKSLGLEYAKARQLALR
RAYPDSFNDDEPDFTGVQKVGAPLSAPASPRMRTGMMTPGDYATLTEEMEHLSTQDYMGA
KSWKGINDDDDENHYPFPLVMKPRKRSDSLASAISGNATPSGGRKLSENDLARADAALSN
VEGVHADGINGHH
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgttccgtccacaacccgttcctttttgaggctgcttgggaagttgccaacaag
gtcggaggtatttacaccgtcatcaagaccaaggtgcctgttactgtcagagaatacggt
gaccgcttatgtttgattggccccttgtcttataaatctgctcctgtagaagtcgaagcc
gaggagcctggaccgggaccgttcggagatgctctcaggtctatgcaggagcgcggcgtc
aagcttctttacggccgatggcttattgaaggcgcccctagagtgttgctctttgacacg
gggtcttgttacgaccgtatggacgaatggaagggtgacctctggaaccttgccggtatc
ccctcgcctccaaatgatcacgagaccaacgaaactatcgtctttggctacatggtcgcc
tggttcctcggcgagttcgctgctcgcgaaaccgacaacgccatcgttgcccacttccat
gaatggcaagccggtttagccatccctctttgtaggaagcgacacattgacgtcaccacc
atcttcaccacccacgcgactcttttgggtcgttacctctgtgctggcagtgtcgacttt
tacaacaacttgcagtactttgacgttgatcatgaagctggtaagcggggtatctaccac
cgttactgtatcgaaaggtcttctgcacactgcgccgatgtgttcaccaccgtcagccac
attaccgcgtttgagagcgaacacttgttgaagaggaagcctgatggtgtcctccccaac
ggtctcaacgttgtcaagtttgccgccatgcacgaattccagaatttgcatgttcagtcc
aaggagaagatcaacgaattcattcgtggtcatttctatggtcactatgactttgacctg
gacaacaccatttacatgttcactgctggtcgttacgagttcaggaacaagggtgtcgac
atgttcattgaaagtttagctcggttgaatcatcgcttgaagaagatgggctccaagacc
accgtcgtcgcattcatcatcatgcccgccgctaccaactcttacactatcgaagctctc
aaaggtcaagctgtcacctcccagctcaaggactgtgtcgagcaagtgaccaatcgtatc
agcaagcgaatctttgaacacgcctgtcgatactctggcgagcacggtacagaggttcct
aatcctgaagatttgctctccaacgaggacagggttttgctcaagcgaagggtgttcgcc
ctgaagcgaaactctctgccgcctatcgtcacgcacaatatggcggatgacgcaaatgac
cctattttgaaccagctcaggagggtacagttgttcaacaggcccgaagacagggtcaag
gttatcttccaccccgaattcttgaacagtaacaaccccatcttgggtctggattatgaa
gagtttgttaggggttgtcacttgggtgttttccctagttactacgagcccttcggttat
acccccgccgagtgtactgtcatgggtattcccaacatcactaccaacttgtccggtttc
ggttgctttatggaagacctcctggagtctcccgaggactacggttgttacattgtcgac
cgacgaggtcaaggtatcgaagaatctgtcgaccagctcaccggccagctgctctctttc
accaccaaatccagaagacagcgtatcaaccagcgtaaccgtactgaacgcctgagcgag
ttgctggactggaagtccctcggtctcgagtacgccaaggctcgtcaattggctttgagg
cgagcttaccccgactcatttaatgatgatgagcccgacttcactggtgtgcaaaaggtt
ggcgcgccgctctctgcgcctgcgagcccgaggatgaggactgggatgatgactcctggg
gattatgccactttgactgaagagatggaacatctttctactcaagactacatgggtgct
aagagctggaaaggcatcaacgatgatgatgacgagaaccattatcctttccctctcgtc
atgaagccccgtaaacgctccgactctctcgcttctgccatctctggtaacgctacccct
tctggcggtaggaagctctccgaaaatgatttggccagggccgatgctgctttgagcaat
gttgagggggttcacgccgacggaatcaacggacatcattag

DBGET integrated database retrieval system