KEGG   Cryptococcus neoformans var. neoformans JEC21: CNK00930Help
Entry
CNK00930          CDS       T00243                                 

Definition
(RefSeq) DNA ligase (ATP)
  KO
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cne00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    CNK00930
Enzymes [BR:cne01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CNK00930
DNA repair and recombination proteins [BR:cne03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     CNK00930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
11:complement(join(290985..291001,291054..291130,291182..291319,291369..291463,291519..291569,291622..291732,291787..292177,292236..292338,292397..292492,292579..292646,292806..292925,293009..293096,293154..293197,293253..293277,293325..293535,293610..293717,293771..293876,293937..294147,294275..294360,294416..294494,294548..294752,294801..294937,294991..295076,295135..295271,295327..295458,295518..295793))
Genome map
AA seq 1065 aa AA seqDB search
MAVHAPYNHAPPPTQEINGQKPTLAPAITLERPADCINRGQYPAFYIICGYLNRLRADAP
HKKYELLTRIFGNWREKVGPDLYPLIRLLLPDKDRERPVYNLKESMLARCYIDILSLEKH
SEAAQRLIKWKQPAGNSPNPTGDFAKVCYNEIKARSTVEEGQLSVEAVNMLLDKLAVGKM
KQKDYVPILKAINMQCTAEEQEWIIRIILKDLHISIRERGVLSAFHPDAIDLYNVCSDLK
RVCWTLYDPGFRLNKNETHLELFHSFLPQLCGRMNDASLENIAKAIGAPKEFIMEEKLDG
ERIQLHMRGNGAQWFYCSRKAKDYTYLYGAHPGEGSLTRYIATAFQDNVRNVILDGEMMV
WDPVVERYLAFGTLKSAALAFSLVKVFDILFLNDHCLSRKRLSERKRLLRSGKIFKNIEN
YKGRLEFVDEKRGKNAKDIREYLERVVETKGEGLVVKKTDVIYQTNSRGYDWIKVKPEYS
DQMGENLEVLVLGGWWGKGGRSGKISRLLCGLREQAFDDGTLQDFLFNRFWNELLGLRVD
FVSHLMHLRSMRCSPTHLSQCRNKHKKHWRPFDRSNPPPFMKLGPVGLDDKPDVYIEPEN
SFVIEVKASEIVPAGYGIGFTLRFPRCKYIYYDKNSRDYALDDECLWTVGQGFFYKTRKL
IKRTDFMDLFSRPKRSYDDSQGPGNFRGQKLSDADVETSIFSDMTFSDLEALVHKHGADF
TQAQLSDLSAIVISPDQKNPLVRAQIRHGVNVIKPEWVFESIARRTALPFLKEFLVFASE
EAQDGRYYNKTLEQYDKVSFVRDRTGGALVDEDGDADVEDEIMDGEDKDEIDVEESRESK
NRRMAREDLKEKESNRTLEQKKLQEAWGLRSRASPGDSDSEPEEEMSLKEESDTDSERSR
GLRAIYEDEEDGENDSHESDVGVNGDDYRAVPLSGLNDKEEGLMGESPEAMHYDEDRIFY
HLAFYIDTAKNAAVNGLESSSPSFDTQERLVKVEKLLIENGGRVARSISDPKLTHIIMDD
EDSRRYVELTRKTAMPKRKHIVTPKWVEDCVDEETLLDEDLYKPK
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggcagtacacgctccatacaatcatgcacctccgcccactcaagaaataaatggtcag
aaaccgacattagcccccgcgataactctcgaacgtccagcggactgtatcaaccgcggc
cagtatcccgctttctacattatctgcggctatcttaacagactacgggcagatgcgccg
cacaaaaagtacgagcttctgacgaggatattcgggaactggagggagaaagtagggcca
gatctttatccgttgatcaggttgttgttacctgataaagatagggaaagacccgtgtat
aatttgaaagagtcaatgttggctcgatgctacattgatatattgtcgttagagaagcac
agcgaggcggctcagaggttgatcaaatggaagcagccggcaggaaattcaccaaatcca
actggagactttgcgaaagtctgttacaatgagataaaagctcgatccaccgtggaggaa
gggcaattgagtgttgaagcagtaaacatgctcctagataagctggctgttggaaaaatg
aagcaaaaagattacgtgccgatactcaaggcaatcaatatgcaatgtacagctgaggaa
caagaatggattatccggattatactcaaagacctgcatatctcaatacgtgaacgaggg
gtcttatcagcgtttcatccggatgcgatagatctgtataatgtttgttcagacctgaag
cgtgtctgttggactttgtatgatcccggcttcaggctcaataaaaatgaaacgcatctt
gaattattccactcctttctccctcaattatgtggccgcatgaatgatgcgtcgctcgaa
aatattgcgaaggctataggagcgccaaaagagttcatcatggaagaaaagttggacggg
gagagaatacagttacacatgagaggaaatggtgcacaatggttctactgttcaaggaaa
gctaaagactatacgtatctatatggcgcccacccaggagagggaagcttgacgcgctac
atagctactgcgttccaggacaatgtcagaaatgtcattcttgacggagagatgatggtt
tgggatcctgtagtggaacgttacctggcttttgggaccctcaagtcagctgcacttgct
ttttcattagtcaaggtgtttgacatccttttcttgaacgatcattgcctttcccgcaaa
cgtttatcagaacgcaagcgtctccttcgctctggaaaaatcttcaagaatattgagaac
tataaggggagattggaatttgtagacgagaaaagagggaagaacgcaaaggatattaga
gagtatttggaaagagtggtcgagaccaaaggcgaaggtttagtggttaagaagacggat
gtgatttatcagacgaactcgagaggatatgactggatcaaggtcaagcccgagtatagt
gaccaaatgggtgagaatttagaagtcttggtgttgggcggatggtggggtaaaggagga
cgttcagggaagatttcaagattactctgcgggttaagagaacaggcgtttgacgatggt
acacttcaagactttctgttcaatcggttctggaatgagctactcggactacgagtggat
tttgtaagtcacctcatgcacttgcgttcaatgaggtgctcacctactcacctatcacaa
tgcaggaataaacacaagaagcattggagaccttttgataggtccaacccaccccctttc
atgaagcttgggccagtgggtctcgatgacaagccggatgtttatatcgagccggaaaac
tctttcgtcatcgaagtaaaggcgtctgaaatcgtgccggcaggctatggaataggattt
actcttcgttttccacgctgtaaatacatttactacgacaagaatagtcgagactatgcg
ctcgatgatgaatgtctgtggacggtaggtcaaggatttttttataagactaggaaactc
ataaaacggacagacttcatggacctcttctcaaggcccaagaggtcgtatgacgatagt
caaggtcctggcaacttccgaggtcagaagctttcagatgcagatgtggaaacgagcata
ttcagcgatatgacgttttctgatctcgaagcacttgtgcataagcatggtgcagatttc
acgcaagcgcagctgtccgacctatcggcgattgttatctctcccgatcaaaagaaccct
ttagtacgagcccagatcagacacggagtcaatgtcatcaaacctgagtgggtatttgag
agtattgcgcggaggacagcattgcctttcttaaaggaattcctggtcttcgcatcggaa
gaagctcaagatgggcgatattacaataagacacttgagcaatacgataaggtttctttt
gtgcgcgatcgtaccggcggggcactcgtcgatgaagatggtgatgccgatgtcgaagat
gagatcatggatggtgaggacaaagatgagattgacgtggaagaaagtcgagaatccaag
aaccgaaggatggccagagaagatctcaaagagaaagaatcgaatagaacgctggagcag
aagaagcttcaggaagcatggggtttgagatcacgagcgagtccaggagattccgatagt
gaacctgaagaggagatgtcgctgaaggaggagagtgacacggattcggaaagaagtagg
gggctccgggcgatttatgaagatgaagaggacggagaaaacgacagtcatgaatcagat
gttggggtaaacggagatgattacagagcggttcccctcagcgggttgaatgacaaggag
gaaggacttatgggagagagtccagaagcaatgcactatgatgaagatcgaattttctat
caccttgcattttacatcgatactgcaaagaacgctgcggttaacggcttggaaagctcg
tctccctctttcgacacccaagaaagactcgtcaaagtcgagaagctgctgatagagaat
ggtggacgtgtggcgagaagcatctccgatcccaagctcacgcacattataatggatgat
gaggattcgagaagatacgtcgagttgacgaggaagactgccatgcccaaaaggaaacac
attgtgacccccaaatgggtggaggattgcgtggatgaagagacattgctggacgaagat
ctgtacaagcccaagtaa

DBGET integrated database retrieval system