KEGG   Cedecea neteri SSMD04: JT31_03315Help
Entry
JT31_03315        CDS       T03298                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cnt  Cedecea neteri SSMD04
Brite
Enzymes [BR:cnt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     JT31_03315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
739641..740222
Genome map
AA seq 193 aa AA seqDB search
MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLVKGSPFEGKSLEEIVQES
DGGIFNNAAQVWNHTFYWHCLAPNAGGEPDGEVLAAINNAFGSVEAFKKQFTEAAIKNFG
SGWTWLVKNSDGSLAIVSTSNAGTPLTTGAKPLLTVDVWEHAYYIDYRNARPVYLDQFWA
LVNWNFVAQNLAG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcgaactacccgccctgccctatgccaaagatgcgctggccccgcatatctcg
gccgaaaccctcgagtaccattacggcaagcatcatcagacctacgtcactaacctgaac
aacctcgtcaaaggcagcccgtttgaagggaaatcgctggaagagatcgtgcaagagtct
gacggcggtattttcaataatgccgctcaggtctggaaccatacgttctattggcactgc
ctggcgccaaacgccgggggagagcctgacggggaagtgttggccgccatcaataacgcg
tttggcagcgtggaagcatttaaaaaacagttcaccgaagcggctatcaaaaacttcggc
tccggctggacctggcttgtgaagaacagcgacggtagcctggctatcgtctcgacctct
aacgcaggaactccgctcacaaccggggcaaaaccgctgttgacagtggacgtctgggaa
cacgcttactacatcgactaccgcaacgcgcgcccggtttatctggaccaattctgggcg
ctggttaactggaactttgttgcgcaaaacctggcaggctga

DBGET integrated database retrieval system