KEGG   Cedecea neteri SSMD04: JT31_15310Help
Entry
JT31_15310        CDS       T03298                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cnt  Cedecea neteri SSMD04
Brite
Enzymes [BR:cnt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     JT31_15310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AIR05933
UniProt: A0A089Q0Z5
LinkDB All DBs
Position
complement(3242276..3242767)
Genome map
AA seq 163 aa AA seqDB search
MAALACTGLAQAATVTMNTVDANGTSTPAGTIEYHATQYGVVFTPNLKGLPPGIHGFHVH
TNPNCGPGMQDGKMVAGLAAGGHLDPAHTGKHEGPWGNGHLGDLPALYVDSDGTATYPVL
APRLRMSDLKGHSLMIHAGGDNHSDHPAMLGGGGARMVCGVTS
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
attgccgccctcgcctgtaccgggctggcgcaggccgccaccgtgaccatgaacaccgtg
gacgccaacggcacttcaacgccagcgggcacaattgaatatcacgccacccaatatggg
gtggtctttacgccaaacctgaaaggcctgccgccgggtattcacggcttccacgtgcac
actaatccgaactgcggccccggcatgcaggacggcaaaatggtggcaggcctggcggcg
ggcggccacttagatccggcccacaccggcaaacacgaaggcccgtggggcaacggccac
ctcggcgacctgcctgcgctgtatgtagacagcgacggcaccgcaacctacccggtgctg
gctcctcgcctgcgaatgtctgacctcaaaggccactcgctgatgatccacgccggcggc
gataaccactctgaccacccggcaatgctcggcggcggcggcgcgcgtatggtgtgcgga
gtgacgtcatga

DBGET integrated database retrieval system