KEGG   Caldicellulosiruptor obsidiansis: COB47_0739Help
Entry
COB47_0739        CDS       T01293                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
cob  Caldicellulosiruptor obsidiansis
Brite
Translation factors [BR:cob03012]
 Eukaryotic Type
  Elongation factors
   COB47_0739
 Prokaryotic Type
   COB47_0739
Mitochondrial biogenesis [BR:cob03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    COB47_0739
Exosome [BR:cob04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   COB47_0739
  Exosomal proteins of breast cancer cells
   COB47_0739
  Exosomal proteins of colorectal cancer cells
   COB47_0739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
863683..864885
Genome map
AA seq 400 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLALKGKAQFMAYDQIDKAPEERERG
ITINTAHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVNVPYIVVFLNKVDMVDDPELIELVEMEVRELLSKYGYPGDEVPIIKGSALKALE
STSQDPNAPEYQCILELMDAVDKYIPTPQRDIDKPFLMPIEDVFSITGRGTVVTGRVERG
TLKTGEEVEIVGFAPEPRKTVVTGIEMFRKVLDEAVAGDNVGCLLRGIQKNEVERGQVLA
KPGTIKPHTKFKAQVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGTITLPEGVEMCMPG
DNVEMTVELISPIAIESGLRFAIREGGRTVGAGSVTTIIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggctaaatttgaaagaacaaaaccacacgtaaacataggtacaattggacac
gttgaccatggaaaaacaacattgacagctgcaatcacaaaagttttggctctcaaaggt
aaagctcagtttatggcttatgaccagattgacaaggctccagaggaaagagaaagaggt
attactatcaacacagcacacgttgagtatgagacagacgcaagacactatgcacacgtt
gactgtccaggtcacgctgactacgtcaagaacatgataacaggtgctgctcagatggac
ggtgcaatcttggttgtatctgcagcagacggtccaatgccacagacaagagaacacatt
ttgcttgcacgacaggttaacgttccatacatcgtagtattcctcaacaaggttgacatg
gtagacgatccagaattgattgagctggttgaaatggaagtaagagagcttctttccaag
tatggttacccaggcgacgaagtaccaatcataaaaggttcagctttgaaggctttagag
tcaacatcacaagatccaaatgctccagagtatcagtgcattttagagctcatggatgct
gttgacaaatacatcccaacaccacagagagacattgacaaaccattcttgatgccaatt
gaagacgtgttctcaatcacaggtagaggtactgttgtaacaggtagagttgaaagagga
acactcaagacaggcgaagaggtcgaaatagttggttttgctccagagccaagaaagaca
gttgtaacaggtattgaaatgttcagaaaggtattggatgaggctgttgctggtgacaat
gtagggtgccttctcagaggtattcagaagaatgaggttgaaagaggtcaggttcttgca
aagccaggcacaattaaacctcatacaaagttcaaagcacaggtttacgtcttgacaaaa
gaagaaggtggaagacatacaccattcttcaatggttacagaccacagttctatttcaga
acaacagacgttacaggaacaatcacactaccagagggtgtagagatgtgcatgcctggt
gacaacgttgaaatgacagttgaacttatctctccaattgctattgagtcaggactcaga
tttgctatccgcgaaggcggaagaacagttggtgcaggttctgttacaacaataattgaa
taa

DBGET integrated database retrieval system