KEGG   Corynebacterium pseudotuberculosis 258: Cp258_0420Help
Entry
Cp258_0420        CDS       T02118                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
coe  Corynebacterium pseudotuberculosis 258
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:coe00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Cp258_0420 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Cp258_0420 (alr)
Enzymes [BR:coe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Cp258_0420 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:coe01011]
 Precursor biosynthesis
  Racemase
   Cp258_0420 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
453892..455004
Genome map
AA seq 370 aa AA seqDB search
MNLLEARIDLDAIAHNTRLIKDKAAAQGAQLMCVVKADGYNHGAVEVATVMEENGADQFG
VATIGEALALREGGIESSILSWIWSPEQDLGAAIAAEIDLAAISLEHVKALVRASESYGK
KPVRVTVKVDTGLHRSGVDKQDWRESFCMLRDAENIQVTGVFSHFSSADESDSTETEQQE
RAFLNAIELGRSLGLELPVNHIANSPATLNRPDLYFDMVRPGLALYGHEPIPGESHGLRE
AMSWVGRVTVVKPIARGEGTSYGLTWRAEQDGYLCVVPVGYADGLPRSAQGHLEITIGGR
RYPQVGRVCMDQIVVALGENPYGVAQGDEAVILGPTGMTATELATAMGTINYELVCRPCG
RTVRVFEHSD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgctcgaggcccgtatcgatttggacgccatcgcacacaacacccgtctgatt
aaagataaagctgcggcacaaggtgcgcagctgatgtgcgtggtaaaagccgatgggtat
aaccatggcgccgtggaagtggccacagtgatggaagaaaatggcgcggatcagtttggt
gtagcgactatcggggaggcccttgcgctaagggagggtgggatagaatcgtcgattctt
tcctggatttggtcgccggagcaagacctcggggcggcgattgctgcagaaattgatctg
gctgcgatctcgcttgagcatgttaaggcgttggtgcgggcgtcggaaagctatggcaaa
aaacctgtacgtgtcaccgtaaaagtagacactggcctgcatcgttctggtgtggataag
caggattggagagagtctttctgcatgctgcgtgatgctgagaatattcaggtcacaggg
gtgttcagccacttttctagtgcagatgaatcggattctacagagacagaacagcaggag
agggcttttctcaacgcgattgaactcgggcgctcgctgggcttggagcttcctgtcaat
cacattgctaattcgcctgcaaccctgaaccggccagatttatattttgatatggttcgt
cctggcctggccctttacggacacgaaccgattcctggagaatctcatggtctacgtgag
gcgatgtcttgggttgggcgagtaacggtggtaaaaccaatcgccaggggagaagggact
agttatggtctcacgtggcgtgcagagcaggacggatacctctgtgttgttcctgttgga
tacgccgatgggttgccgcgctctgcgcaaggacatttagaaatcacgattggtggacga
aggtatccgcaagtgggtcgcgtgtgtatggatcagatcgtggtggctttaggcgaaaac
ccttatggtgtggctcaaggcgatgaggcagtcattctcggtccgacgggcatgaccgcc
acggagctcgccacagcaatggggacaatcaactatgaactcgtgtgtcgtccttgcggg
cgcaccgtgcgagtatttgagcacagcgattaa

DBGET integrated database retrieval system