KEGG   Corynebacterium pseudotuberculosis CIP 52.97: CpCIP5297_0342Help
Entry
CpCIP5297_0342    CDS       T02054                                 

Gene name
tuf
Definition
(GenBank) Elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
coi  Corynebacterium pseudotuberculosis CIP 52.97
Brite
Translation factors [BR:coi03012]
 Eukaryotic Type
  Elongation factors
   CpCIP5297_0342 (tuf)
 Prokaryotic Type
   CpCIP5297_0342 (tuf)
Mitochondrial biogenesis [BR:coi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CpCIP5297_0342 (tuf)
Exosome [BR:coi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CpCIP5297_0342 (tuf)
  Exosomal proteins of breast cancer cells
   CpCIP5297_0342 (tuf)
  Exosomal proteins of colorectal cancer cells
   CpCIP5297_0342 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
371132..372322
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAYPDLNEAFAFDAIDKAPEEKE
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEIRELLAEQDYDEEAPIIHISALKAL
EGDEEWTKSILELMQACDDSIPDPERETDKPFLMPIEDIFTITGRGTVVTGRVERGQLNV
NEDVEIIGIKEKSTQTTVTGIEMFRKLLDYTEAGDNCGLLLRGIKREDVERGQVVVKPGA
YTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNVD
MSVTLIQPVAMDEGLRFAIREGSRTVGAGRVTKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggctaagttcgagcgtactaagccgcacgttaacatcggtaccatcggtcac
gtcgaccacggcaagaccaccactaccgctgctatcaccaaggttctggctgacgcatac
ccggatctcaacgaggctttcgccttcgacgccattgacaaggcaccggaggagaaagag
cgtggcatcacgatcaacatctcccacgttgagtaccagaccgagaagcgccactacgca
cacgtggatgctccgggtcacgccgactacatcaagaacatgatcaccggcgctgctcag
atggacggcgcaatcctcgtggttgctgctaccgacggcccaatgcctcagacccgtgag
cacgttctgctcgctcgccaggttggcgttccttacatccttgttgctcttaacaagtgc
gacatggttgacgatgaggaaatcatcgagctcgtcgagatggagatccgtgagctgctc
gctgagcaggattacgatgaagaggctcctatcatccacatctccgctctgaaggctctt
gagggcgacgaggagtggaccaagtccatcctcgagctcatgcaggcttgcgatgattcc
atcccggatccagagcgcgagaccgacaagccattcctcatgcctatcgaggacatcttc
accatcaccggtcgtggcaccgttgttaccggccgtgttgagcgtggccagctgaacgtc
aacgaggacgttgagatcatcggtatcaaggaaaagtccacccagaccaccgttaccggt
atcgagatgttccgtaagcttctcgactacaccgaggctggcgacaactgtggtctcctc
ctccgtggtatcaagcgcgaagacgttgagcgcggtcaggttgttgttaagccaggcgct
tacactcctcacaccgagttcgagggctctgtctacgtcctttccaaggacgagggcggc
cgccacaccccgttcttcgacaactaccgtcctcagttctacttccgcaccaccgacgtt
accggtgttgtgaagcttcctgagggcaccgagatggttatgcctggcgacaacgtcgac
atgtccgtcaccctgatccagcctgtcgctatggacgagggcctgcgcttcgctatccgc
gagggctcccgcaccgttggcgctggccgcgtcaccaagatcatcaagtaa

DBGET integrated database retrieval system