KEGG   Capnocytophaga sp. oral taxon 323: AM608_06725Help
Entry
AM608_06725       CDS       T04076                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
col  Capnocytophaga sp. oral taxon 323
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:col00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AM608_06725
Enzymes [BR:col01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AM608_06725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1568276..1569685
Genome map
AA seq 469 aa AA seqDB search
MKYYIYLLAGLLAFSCDKKSNNDNPEPQNTVPLDLTKIDNGNRVMMQAFYWDVEPRGEWW
NTITPKLSDWKANGVDRIWLPPASKGASGGYSMGYDPSDYFDFGEYNQHGTVKTRFGSRA
ELENLISKAHESGLQVIADIVIGHNNGGGKEWNPYRNKETYTLFDKTHGNASGRFDRNYE
CFHPNKYATSDEGADFYGEQDLSHKVPYVREELWEKDNSMAKYYKNTMKFDGWRFDYVKS
FGAWVVRDWLKAVGGFAVGELWDGNPETLKKWVDESGASAFDFACFYALEKALDRNKDMH
ELMTDTHPMLRTLRTEKAVTFTANHDTEKDNIADNTIAADKKLMAYAYILTHSGYPCIFY
SDYENEAFKAKLQKLMLINRSLAVGEEKFHLASNTEYVASRLGNEKSPGLVLFINNSTLP
AKRTITTHWKNKTLIDYSGNSHLFFVTDSDGNVTIQVPANSYTVWSIGK
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattatatataccttctcgcaggattgctcgccttttcctgcgataaaaaaagc
aacaacgacaacccagaaccccaaaatacagttcccttagaccttactaaaatagacaac
ggcaatcgcgtaatgatgcaagccttctactgggacgtagaaccccgcggagaatggtgg
aatactattacccctaaactctccgattggaaagccaacggggtagaccgcatatggcta
ccacctgcctccaaaggagcttctgggggctattctatgggctacgacccctccgattat
ttcgattttggcgaatataaccaacacggcactgtaaaaacccgcttcggctcacgcgct
gaactcgaaaaccttatcagcaaagcccacgaaagtggcttgcaagtaattgccgatatc
gttataggacataacaatggcggaggcaaagagtggaacccttaccgcaataaagagacc
tacacccttttcgataaaacccacggtaatgcttctggaagatttgaccgcaactatgag
tgctttcaccctaataaatatgcaacttctgacgaaggagctgacttttacggagaacaa
gacctctcgcataaagtaccctatgtacgtgaagaactttgggaaaaagataactcaatg
gctaagtattacaagaatacaatgaagtttgacggttggcgtttcgactatgtgaagagc
tttggagcttgggtagtacgcgattggttaaaagcagtaggtggtttcgccgtaggtgaa
ttgtgggacggcaaccccgaaacgcttaaaaaatgggtagacgagagcggtgcaagtgct
ttcgactttgcctgtttttatgccctcgaaaaggcattagaccgcaataaagatatgcac
gaactgatgaccgatacccacccaatgcttagaaccttacgcaccgagaaagccgtcact
tttacagctaaccacgataccgaaaaagacaacattgctgataataccattgcggctgac
aaaaaactaatggcgtatgcctatatccttacccacagtggctacccttgtattttctat
tccgattacgaaaatgaggctttcaaagccaagctacaaaagctaatgctcatcaaccgc
agtttggcagtaggcgaagagaaatttcacttagcctctaatacggagtatgtagcttca
cgtctgggcaacgagaaaagtccgggcttagtgctctttatcaacaacagtactctccct
gccaagcgtactatcaccacccattggaaaaacaaaaccctgatagattactctggtaat
agtcatttattttttgttaccgatagcgacggcaatgtaaccatacaagtacccgccaat
agctacactgtgtggtcaataggtaaataa

DBGET integrated database retrieval system