KEGG   Corynebacterium pseudotuberculosis 42/02-A: Cp4202_1987Help
Entry
Cp4202_1987       CDS       T02053                                 

Gene name
sodA
Definition
(GenBank) Manganese superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cos  Corynebacterium pseudotuberculosis 42/02-A
Brite
Enzymes [BR:cos01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Cp4202_1987 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2206709..2207311
Genome map
AA seq 200 aa AA seqDB search
MAKYELPELDYAYDALEPHIAAEIMELHHSKHHANYVNGANAALEKLADARENGYIGVAV
TALSKDLAFNLGGHTNHSIFWKNLSPNGGGEPTGDLAEAISAEFGSFDKFKEHFSAAALG
LQGSGWAVLGYDHVGERLVIEQLTDQQGNISANLTPLLMLDMWEHAFYLQYKNVKADYVK
AVWNVFNWEDVAARYEAATK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctaagtacgaactgcccgaactcgattatgcttacgacgctctcgagccccacatc
gctgctgagatcatggagctccatcactccaagcaccatgcaaactacgtaaacggtgct
aacgcggccctggagaagcttgccgacgcccgcgagaacggctacatcggcgttgctgtt
accgccctctccaaggatcttgcttttaacctcggcggacacaccaaccactccatcttc
tggaagaacctctcaccgaacggtggcggcgagccaaccggcgacctcgcagaggcaatc
agcgctgaatttggttcctttgacaagttcaaggagcacttctctgcagcagccctcggc
cttcagggctccggatgggcagtgctcggatacgaccacgttggtgagcgccttgtcatc
gagcagcttaccgaccagcagggcaacatctccgctaacctcaccccactactcatgctc
gacatgtgggagcacgctttctacctgcagtacaagaacgtaaaggcagactacgtcaag
gcagtatggaacgtgttcaactgggaggacgttgcagcacgctacgaggcagctaccaag
taa

DBGET integrated database retrieval system