KEGG   Candida orthopsilosis: CORT_0A04600Help
Entry
CORT_0A04600      CDS       T02488                                 

Definition
(RefSeq) Gad1 glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
cot  Candida orthopsilosis
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cot00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CORT_0A04600
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CORT_0A04600
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CORT_0A04600
   00430 Taurine and hypotaurine metabolism
    CORT_0A04600
Enzymes [BR:cot01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CORT_0A04600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(991774..993537)
Genome map
AA seq 587 aa AA seqDB search
MFQLPRFTSISKQLIRQFTKYPPTMVLSKHIDAYDLEYELLKDSRKVKLSPDEFNDEYNS
SKLTPRYVIPKESANEADIYKYMNQNLALDGIPTLNLASFVNTYVDEHQKKLAVENLTKN
LADNDEYPSLIDIQNRCVTMLSNLWHAPHKIDPNTGAKIVNSLGTATTGSSEAIMLAGLA
LKKRWQEKRKAEGKSTENPNILMATCAQVALEKFAVYFDVENRLIPINPESGHLIDTTKI
KENIDENTIGIFVIMGSTFTGAFEPVEEISKLLDEVEKEKGLDIRIHVDGASGGFVAPFA
FPHLKWDFAVDRVDSINTSGHKFGMTSVGLGWVIWKDESLLPKNLRFSLDYLGGVEETFG
LNFSRPGFPVILQYYNFLTFGKEGYTKIFDGCLSNARLLSNYLDKSTYFDVVSVIHKPAS
AEDQKRLLTRQVKYLPSPTVNENFQPGLPVVAFRFSKEVRDKYPEIPQELFSTLLRKRGF
IVPNYHLPPDETNVEILRVVVRNSLGLALLEKLIEDCTEIAELLIKSAESVREILTNKEQ
ASKHNTSTIHDLLLSIASGGLQPLRQKQHERDGHKAGVAKKSYRGTC
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaactcccacgatttacttcgattctgaagcaattgattagacaattcaccaaa
tatccacccacaatggttttaagtaaacacattgacgcttacgatttagaatatgagctt
ttaaaagattcacgcaaggttaaattgagtcctgatgaattcaatgatgaatataactca
tccaaattgactccaagatacgttattcctaaagaatcagccaatgaagcggatatttac
aagtatatgaatcaaaatttggcattggatggtatcccaaccttgaatttggcttcattt
gtcaacacttatgttgatgagcatcaaaagaaattggcagtggagaacttaaccaagaac
ttggctgataatgatgagtatccttcattaattgatattcaaaatagatgtgttaccatg
ttgagtaacttgtggcatgctcctcacaaaattgacccaaacactggtgccaagattgtc
aattccttgggaactgcaactaccggatcatcggaagctattatgttggcaggtttggct
ttaaagaagagatggcaagaaaaaaggaaagccgaaggtaaatccactgaaaatccaaac
attttgatggctacttgtgctcaagttgctttggagaaatttgctgtttattttgatgtt
gaaaatagattgattccaattaatccagaatcgggtcatttaatcgataccaccaagata
aaagaaaacattgatgaaaatacaattggtattttcgtgattatggggtctacgtttact
ggtgcttttgaaccagttgaagaaatttccaagcttttggatgaagttgaaaaggaaaaa
ggattggatattagaatccatgttgatggtgcttctggtggatttgttgccccttttgct
ttcccacatttgaaatgggattttgctgttgaccgtgttgattcaataaacacttcagga
cataagtttggtatgacttctgttggattgggttgggttatttggaaagatgaaagttta
ttgccaaagaatttacgttttagtcttgattatttgggtggtgttgaagaaacttttggt
ttgaatttctcaagacctgggtttccagtgattttacaatactacaacttccttactttt
ggtaaagaagggtataccaagatctttgatggttgcttatccaatgctcgtttgctttcc
aattatttggacaagagtacttattttgatgtcgtatcggtcattcacaaaccagctagt
gctgaagaccaaaagaggttactcaccagacaagtcaaatatttgccatctccaactgtt
aacgagaatttccaaccaggtttaccagttgttgcttttagattctccaaagaagtaaga
gacaagtatcctgaaattcctcaagagttgttttccaccttgttgcgtaaacgtggattt
attgtccccaactatcatttaccaccagacgaaaccaatgttgagattttacgtgttgtt
gtacgtaattctcttggtttggctcttttggaaaaattgattgaagattgtactgaaatt
gctgaattattgattaagtcggctgaatcagttagagagatcttgacaaataaggaacaa
gcctcgaaacataatacttcaactattcatgatttgttgttgagtattgcttctggtggt
cttcagccacttagacaaaagcaacatgagagggatggtcataaagctggtgttgccaag
aagtcataccgtggaacttgttaa

DBGET integrated database retrieval system