KEGG   Candida orthopsilosis: CORT_0B00530Help
Entry
CORT_0B00530      CDS       T02488                                 

Definition
(RefSeq) Sod1 superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cot  Candida orthopsilosis
Pathway
cot04146  Peroxisome
cot04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cot00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    CORT_0B00530
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    CORT_0B00530
Enzymes [BR:cot01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CORT_0B00530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 14538249
NCBI-ProteinID: XP_003867212
UniProt: H8WZA6
LinkDB All DBs
Position
2:complement(join(86715..87166,87312..87324))
Genome map
AA seq 154 aa AA seqDB search
MVKAVAVLRGDSNVSGVVRFEQTAESEPTTISWEIAGNDPNALRGFHVHAFGDNTNGCTS
AGPHFNPFSKTHGAPEDDERHVGDLGNISTDSQGVAKGTKQDLLIKLIGANSILGRTVVV
HAGTDDYGKGGFEDSKTTGHAGARPACGVIGLSE
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaagcagttgctgtacttagaggagactcaaacgttagcggagtcgttagattc
gaacaaaccgcagaatctgaaccaaccacaatcagttgggaaattgctggtaatgaccct
aacgcattaagaggattccacgtccatgcatttggtgacaataccaatggatgtacttct
gccggtcctcatttcaacccattcagcaagactcatggggctccagaagatgatgaaaga
catgttggtgacttgggtaacatttctactgattctcaaggtgttgctaagggaacaaaa
caagatttgttgattaaattgattggtgctaatagtatccttggtagaactgttgttgtt
catgcaggtactgatgattatggtaaaggtggttttgaagattcaaagactactggacat
gcgggtgctagaccagcctgtggtgttattggattatcagagtag

DBGET integrated database retrieval system