KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_0386Help
Entry
Cp162_0386        CDS       T02154                                 

Gene name
nanH
Definition
(GenBank) Neuraminidase (Sialidase)
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cou00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Cp162_0386 (nanH)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Cp162_0386 (nanH)
Enzymes [BR:cou01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Cp162_0386 (nanH)
Bacterial toxins [BR:cou02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Cp162_0386 (nanH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
436120..438204
Genome map
AA seq 694 aa AA seqDB search
MTDSHRRGTRKALVTLTAALALTTQGLTAPATLAEEGSIIVPAPIDNNGLFDAAPPAPVA
RGAVGEGKLPDPVTSEFFDSKVIRDVDPAGQRCFRIPAIATAVDGTLLVAFDNRYGPGEQ
SKTWCRDAPYNNKGVNTQEMQTDIEIYRSHDSGESFEKGDFIAKGTEDPRDLSYTDPSIV
VDHETGKIFAVFVRGYDYRFFDAHAGVNSGDPNARIARRDVQDTVIIESNDNGQTWGNMK
LLSELTEKIKVRHKPGQELAGRGRFATSGNGIQLKYGENAGRLLFPMSVHYSPNGAGAVA
NVALYSDDHGATWNVGQGVGGEGEPNGDENKLVELSDGRIMMNSKSTGSNPSDPRGAERW
RSYSEDQGETWGKPEPVIVAPPQHPLQRNTGINVSLIRAYPSAPEGSAAARVLLYSAPID
TRIKGEYGQDGRSNGWVMASCDDGRSWTHGRQIEAGRFQYSVMTPMADGNIGMVYESGDK
ERGMTLKFAKFNMAWLGADCLSNKALGITDLPDPALAKAIEDAKAATAKAEEATANVLKL
TKELEEAELENEELAQALAEAKSAAQDAIAAAEEANARVKAAEGATTEAKEAAMKAGNEA
KALAEQLAKVEAELANSQDQAKALAEAKEAAEIARKAAEEALKLEKEKSGKAGGTDNTEN
KGFWQELLRIFPGFAPIFSFLASIWSGMQKLLAF
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgacggattcacaccgccgtggaactcgcaaagcgctggtaacactcacagcagcgctg
gcgctcaccactcaaggccttacggctcctgcgactcttgctgaagagggttcgatcatc
gtacctgcacccattgataataatgggcttttcgacgctgccccgcccgcgcccgtagcg
cgtggtgcagtgggggagggtaagcttcccgaccctgtaaccagcgaattttttgattcg
aaggttattagagacgtagacccggcaggacagcggtgcttccgtattccagctatcgct
acagcagtagatggaactcttttggtggcatttgataaccgttatgggccgggggagcaa
agcaagacctggtgtagggatgctccttataacaataagggagtcaatactcaggaaatg
cagacggatattgagatttatcgctctcatgattccggtgaatcctttgagaagggcgac
ttcattgctaaggggaccgaggatcctcgggatctttcctataccgatccctcaatcgtt
gtagaccatgaaacggggaagatatttgcagtctttgtgcggggttatgactaccgcttc
tttgatgcccatgcgggcgtgaattcgggcgatccgaacgctaggattgcccgcagagat
gttcaagataccgtcataattgaatcgaacgacaacggtcaaacctggggaaacatgaag
cttctcagcgagttgacggagaaaattaaagtccggcacaagcctgggcaagagcttgcg
ggtcgtggaagatttgcgacctctggtaacggaatccaattaaagtacggagaaaatgcg
ggacggttacttttcccaatgtcggtgcactacagcccaaatggtgctggggctgtagca
aacgtagcgctttattccgatgaccatggggcgacctggaatgttggacaaggcgtcggg
ggcgagggagagccgaacggggatgagaataaactagtggagctttctgatggtcgaatc
atgatgaattcgaagagtacgggaagtaatcctagtgatccgagaggagcagagcgttgg
aggtcttattcagaggatcagggagaaacctggggtaagcctgaaccggtaatcgttgca
ccacctcagcacccattgcaaagaaatactggtatcaatgtttctctaattagggcatac
cctagtgccccggaaggcagtgctgccgcgcgggtgctcttgtactctgctccgattgat
acccgaattaaaggagaatacgggcaagacggtcgtagcaatggttgggtcatggcctct
tgcgatgacggtaggtcgtggacgcacgggcgtcagatcgaagctggccgtttccagtac
tcggtcatgactcctatggctgacggcaatataggcatggtgtatgaatctggcgataag
gaaaggggaatgaccctcaagtttgccaagttcaacatggcttggctgggagccgattgc
ttgagcaacaaagctctgggcattaccgatttgccggatcctgctttggctaaggctatt
gaagacgcgaaggctgcgacggctaaggctgaggaagctacggcgaacgtgctaaagcta
actaaggagctagaagaagccgagcttgaaaacgaagagcttgcacaggctctggctgag
gctaagagtgcagcacaggatgctatcgctgccgctgaggaggctaatgctcgggttaaa
gcggctgagggagctacgactgaggctaaagaagctgcaatgaaagcagggaatgaggct
aaagcgttagcggaacaattggctaaggttgaggcggagctagcaaattcccaagatcaa
gccaaggccttggctgaggctaaagaggctgctgagatcgctcggaaggcagcggaagag
gcccttaagctggaaaaggagaagtctggaaaagccggcggtacagataacactgaaaat
aaaggtttttggcaagaacttttgcggatttttccgggatttgcacctattttcagtttc
ctagcgtcgatatggagcggcatgcagaagttgctagcgttttaa

DBGET integrated database retrieval system