KEGG   Caldicellulosiruptor owensensis: Calow_0656Help
Entry
Calow_0656        CDS       T01347                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
cow  Caldicellulosiruptor owensensis
Brite
Translation factors [BR:cow03012]
 Eukaryotic Type
  Elongation factors
   Calow_0656
 Prokaryotic Type
   Calow_0656
Mitochondrial biogenesis [BR:cow03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Calow_0656
Exosome [BR:cow04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Calow_0656
  Exosomal proteins of breast cancer cells
   Calow_0656
  Exosomal proteins of colorectal cancer cells
   Calow_0656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
758230..759432
Genome map
AA seq 400 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLALKGKAQFMAYDQIDKAPEERERG
ITINTAHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVNVPYIVVFLNKVDMVDDPELIELVEMEVRELLSKYGYPGDEVPIIKGSALKALE
STSQDPNAPEYQCILELMDAVDKYIPTPQRDIDKPFLMPIEDVFSITGRGTVVTGRVERG
ILKTGEEVEIVGFAPEPRKTVVTGIEMFRKVLDEAVAGDNVGCLLRGIQKNEVERGQVLA
KPGTIKPHTKFKAQVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGTITLPEGVEMCMPG
DNVEMTVELISPIAIESGLRFAIREGGRTVGAGSVTTIIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggctaaatttgaaagaacaaaaccacacgtaaacataggtacaattggacac
gttgaccatggaaaaacaacattgacagctgcaatcacaaaggttttggctctcaaaggt
aaagcacagtttatggcttatgaccagattgacaaggctccagaggaaagagaaagaggt
attacaattaacacagcacacgttgagtatgagacagacgcaagacactatgcacacgtt
gactgtccaggtcacgctgactacgtcaagaacatgataacaggtgctgctcagatggac
ggtgcaatcttggttgtatctgcagcagacggtccaatgccacagacaagagagcacatt
ttgcttgcacgacaggttaacgttccatatatcgtggtattcctcaacaaggttgacatg
gtagacgatccggaattgattgagctggttgaaatggaagtaagagagcttctttccaag
tatggttacccaggcgatgaagtgccaatcataaaaggttcagctttaaaggctttagag
tcaacatcacaagatccaaatgctccagagtatcagtgcattttagagcttatggatgct
gttgataaatacattccaacaccacagagagacattgacaaaccattcttgatgccaatt
gaagacgtgttctcaatcacaggtagaggtactgttgtaacaggtagagttgaaagagga
atactcaagacaggtgaagaggttgaaatagttggttttgctccagagccaagaaagaca
gttgtaacaggtattgagatgttcagaaaggtattggatgaggctgttgctggtgacaat
gtagggtgtcttctcagaggtattcagaagaatgaggttgaaagaggtcaggttcttgca
aagccaggtacaattaagcctcatacaaaattcaaagcacaggtttacgtcttgacaaaa
gaagaaggtggaagacatactccattcttcaatggttacagaccacagttctatttcaga
acaacagacgttacaggaacaattacactgccagagggtgtagagatgtgcatgcctggt
gacaacgttgagatgacagttgaacttatctctccaattgctattgagtcaggacttaga
tttgctatccgcgaaggcggaagaacagttggtgcaggttctgttacaacaataattgaa
taa

DBGET integrated database retrieval system