KEGG   Colwellia sp. PAMC 20917: A3Q34_11665Help
Entry
A3Q34_11665       CDS       T04511                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
coz  Colwellia sp. PAMC 20917
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:coz00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    A3Q34_11665
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A3Q34_11665
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A3Q34_11665
   00430 Taurine and hypotaurine metabolism
    A3Q34_11665
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    A3Q34_11665
Enzymes [BR:coz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     A3Q34_11665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2708275..2709903
Genome map
AA seq 542 aa AA seqDB search
MTTNKRTAKATQESLHSIFTIPEAPDSTLGLIEKEISENLAGFLGNHIAAKERALSEIEK
DFASSAIPEEPSFVSDHTRHILDKVVAQSVHTSSPSFIGHMTSALPYFILPLSKLMVGLN
QNLVKIETSKAFTPLERQVLGMMHRLVYKDNDHFYEQWMHSANHSLGAFCSGGTVANLTA
FWVARNNLLKADGDFKGIAREGLFNALKHYKYDGLVILVSDRGHYSLKKSADILGIGQDS
VISIPTDGHNRIDCQKLREKCLELKQRNIRVLSIVGVAGTTETGNIDPLDKMADIAEEFQ
THFHVDAAWGGATLLSNKYRPLLKGIERADSVTIDAHKQMYVPMGAGLVVFKNPASVASI
EHHAEYILRKGSKDLGSHTLEGSRPGMAMLVYASLHIISRPGYEMLINQGIDRARYFAER
INQHADFELITEPELCLLTYRYNPKAVQNLLANSSAEQQDKINDLLDDLTKFIQKRQREN
GKSFVSRTRIEVQRYQGRKTVVFRVVLANPLTSNEILNDVLVEQLELAQESETFLPDLLS
LT
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaataagcgcacagcaaaagcgactcaagagtctttacacagtatttttacc
attccagaagcacctgattcgacattggggctgatcgaaaaagaaatatcagaaaatctt
gctggttttttaggtaatcatattgctgctaaagaacgtgccttaagcgaaattgaaaaa
gatttcgctagctcggctattcccgaagaacctagttttgtctctgatcatactcgccat
attttagataaagttgttgcacaatcagtgcatacatcaagcccaagttttattggtcat
atgacctcagctttaccttactttattttaccgctttctaaattgatggtgggtttaaat
caaaatttagtcaaaattgagacatcaaaagcatttaccccacttgaacgtcaagtgcta
ggtatgatgcatcgtttggtttataaagataatgaccatttttatgagcaatggatgcac
agtgctaaccattcattaggtgccttctgttctggtggcactgtcgccaatttaacggcc
ttttgggtagcgcgtaataatttgttgaaagctgatggtgatttcaaaggtattgcacga
gaaggcttatttaacgcattaaaacattataaatatgatggcttagtgattttagtgtct
gaccgtggccattattcattaaagaagtctgctgatatcctagggattggtcaggacagc
gtgatatcaattcctaccgatggccataaccgcattgattgccagaaattacgtgaaaaa
tgccttgagttgaaacaaagaaacatccgcgtattaagtattgttggcgttgctggtacg
acagaaacaggtaacattgatccattagataaaatggctgatattgctgaagagtttcaa
acacactttcatgtcgatgcagcatggggtggcgcgacattattatcaaataaataccgt
ccactgcttaagggaattgaacgcgctgattcagtaactatcgatgctcacaagcaaatg
tatgtgcccatgggcgcaggccttgtggtgtttaaaaatccggcttctgtggcttctatt
gaacaccatgccgaatatattttacgtaaaggttcaaaagatttaggctctcataccttg
gagggatcaagacccggtatggcgatgttggtttatgcaagcttacatattatcagtcga
cctggttatgaaatgttgattaaccaaggaattgacagagcacggtattttgcagaacgc
attaatcagcatgctgactttgagttaataactgaaccagagttatgtttattaacctat
cgctacaatccaaaagcggttcaaaacttattagcaaatagttcagcagaacaacaagat
aagattaatgatttactcgatgacctgactaaatttattcaaaaacgtcaacgtgaaaat
ggtaaatcatttgtttcacgtacgcgtattgaagtgcagcgttatcaaggtcgaaaaacg
gtggtttttcgtgttgtattggcgaatccattaacctccaatgaaattcttaatgatgtg
ctagtggagcaacttgaattggctcaagaaagtgaaacctttctacctgatttattgtct
ttaacttag

DBGET integrated database retrieval system