KEGG   Carica papaya (papaya): 110814144Help
Entry
110814144         CDS       T05151                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00630  Glyoxylate and dicarboxylate metabolism
cpap00710  Carbon fixation in photosynthetic organisms
cpap01100  Metabolic pathways
cpap01200  Carbon metabolism
Module
cpap_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cpap_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
cpap_M00532  Photorespiration
cpap_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cpap00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    110814144
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110814144
Enzymes [BR:cpap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     110814144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 110814144
NCBI-ProteinID: XP_021897206
LinkDB All DBs
Position
Unknown
AA seq 175 aa AA seqDB search
MSASTVFTAPVSGSSYVRFQPVRQTLFPVKDSISWSRKTVSNGSRTYCMKTWKPINNKKF
ETFSYLPPLSDESIAKEIDYMIEKGWIPCLEFNEAGNVHRENSRIPGYYDGRYWTLWKLP
MFGCNDSGQVLNEIHECKKACPNAYIRCLAFDNRRQCQCMAFIIQKPAVAGDRSS
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgagtactgtgtttactgctccagtttctggatcgagctacgtcaggtttcaa
cccgtaaggcagactctgtttccggttaaagactccatttcgtggagtaggaaaactgtg
tctaatggctcgagaacttactgcatgaagacatggaaaccgattaacaacaagaagttc
gagaccttctcctaccttcctcctctgtccgacgagtcaatcgctaaggagatcgactac
atgatagaaaagggttggattccatgccttgaattcaatgaggcaggaaatgtccacaga
gagaacagccggattcccggatactacgacgggagatactggacgctgtggaaactgccg
atgtttggatgcaacgattctggtcaagtcctgaacgaaatccatgaatgcaaaaaggct
tgcccgaatgcttatattaggtgtctggctttcgacaaccgccgtcagtgtcagtgcatg
gcttttattatccaaaaacccgccgtcgccggcgatcggagcagctga

DBGET integrated database retrieval system