KEGG   Carica papaya (papaya): 110814144Help
Entry
110814144         CDS       T05151                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512-like
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
cpap  Carica papaya (papaya)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cpap00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    110814144
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110814144
Enzymes [BR:cpap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     110814144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 175 aa AA seqDB search
MSASTVFTAPVSGSSYVRFQPVRQTLFPVKDSISWSRKTVSNGSRTYCMKTWKPINNKKF
ETFSYLPPLSDESIAKEIDYMIEKGWIPCLEFNEAGNVHRENSRIPGYYDGRYWTLWKLP
MFGCNDSGQVLNEIHECKKACPNAYIRCLAFDNRRQCQCMAFIIQKPAVAGDRSS
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgagtactgtgtttactgctccagtttctggatcgagctacgtcaggtttcaa
cccgtaaggcagactctgtttccggttaaagactccatttcgtggagtaggaaaactgtg
tctaatggctcgagaacttactgcatgaagacatggaaaccgattaacaacaagaagttc
gagaccttctcctaccttcctcctctgtccgacgagtcaatcgctaaggagatcgactac
atgatagaaaagggttggattccatgccttgaattcaatgaggcaggaaatgtccacaga
gagaacagccggattcccggatactacgacgggagatactggacgctgtggaaactgccg
atgtttggatgcaacgattctggtcaagtcctgaacgaaatccatgaatgcaaaaaggct
tgcccgaatgcttatattaggtgtctggctttcgacaaccgccgtcagtgtcagtgcatg
gcttttattatccaaaaacccgccgtcgccggcgatcggagcagctga

DBGET integrated database retrieval system