KEGG   Clostridium pasteurianum DSM 525 = ATCC 6013: CLPA_c30870Help
Entry
CLPA_c30870       CDS       T03753                                 

Gene name
dpnB
Definition
(GenBank) type-2 restriction enzyme DpnII
Organism
cpat  Clostridium pasteurianum DSM 525 = ATCC 6013
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3318187..3319047)
Genome map
AA seq 286 aa AA seqDB search
MKNRNFDEWLDKFRISISRYDYYINFNKVVSNVEKIKVELNILNSLIGSKNIENDFENII
SKYPETLKCIPTLLAVRQSEIYAQDKDGAFMYNFNEMNFGIEQYSVFMKKTGLFDLISNH
LVNNLVDYALGTETGLDSNGRKNRGGHQMEDLVEEYIKKSNVKEYYKEMYLADIETKWDI
DLSALSNNGKARKRFDFVVKTDSMIYAIETNFYGGTGGGSKLNETARSYKMLSQESDTVD
GFTFVWLTDGTAWRSARGNLRETFDVMDHIYSIDDMENGIMDKVFV
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatagaaattttgatgaatggttagacaagtttagaataagtatttctaggtat
gattattatattaatttcaataaagtagttagcaatgtagagaaaattaaagttgaatta
aatattttaaattcattgataggttcaaagaatatagaaaatgattttgaaaatatcatt
agtaagtatcctgagaccttaaagtgtattccaacattattggctgtacgccaaagcgag
atttatgcacaagataaagatggtgcatttatgtataatttcaatgaaatgaattttggc
atcgaacaatatagtgtatttatgaaaaagacaggattatttgatttgatatctaatcac
cttgtaaataatttagttgactatgctttaggtacagagactggtttggactcaaacgga
agaaagaaccgtggtggtcatcagatggaagatttggtagaagaatatattaagaagtca
aatgttaaagagtattataaagaaatgtatttagctgacatagaaacaaaatgggatatt
gatttatctgctttatccaataatggaaaagcaaggaaaagatttgattttgttgtaaaa
acagatagcatgatatatgcaattgaaaccaacttttatggtgggacaggcggtggctct
aagctgaatgaaacagctagaagttataaaatgctttctcaagaatctgatacagtagat
ggatttacttttgtatggttaacagatggaacggcatggcgaagtgcaagaggaaacctt
agagaaacatttgatgtaatggaccacatttatagcattgatgatatggaaaatggcatt
atggataaagtgttcgtataa

DBGET integrated database retrieval system