KEGG   Corynebacterium pseudotuberculosis 316: Cp316_1947Help
Entry
Cp316_1947        CDS       T01753                                 

Gene name
adhA
Definition
(GenBank) Alcohol dehydrogenase GroES-like protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cpg  Corynebacterium pseudotuberculosis 316
Pathway
cpg00010  Glycolysis / Gluconeogenesis
cpg00071  Fatty acid degradation
cpg00350  Tyrosine metabolism
cpg00625  Chloroalkane and chloroalkene degradation
cpg00626  Naphthalene degradation
cpg01100  Metabolic pathways
cpg01110  Biosynthesis of secondary metabolites
cpg01120  Microbial metabolism in diverse environments
cpg01130  Biosynthesis of antibiotics
cpg01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cpg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp316_1947 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    Cp316_1947 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cp316_1947 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cp316_1947 (adhA)
   00626 Naphthalene degradation
    Cp316_1947 (adhA)
Enzymes [BR:cpg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cp316_1947 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C adh_short Methyltransf_25 TrkA_N Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AFB73229
LinkDB All DBs
Position
complement(2044570..2045607)
Genome map
AA seq 345 aa AA seqDB search
MKTDFPEAFTAAVVDNFGPELNIHDVVLPEPGPNQALVKLVASGICHTDLHAAEGDWPVK
PEPPFVPGHEGVGEVVKLGPGHHRVQLGDMVGNVWLWSACGECEYCRAGRETLCNDAEYG
GYTVDGSFGEYMLVDTRYCARIPEGSDPVEVAPILCAGVTVYKGLKETECKPGQYMVISG
IGGLGHIAVQYAVAMGMRVIAVDIADEKLELARKHGAEFAVNALKEDPVESINAFTSGGA
HGVLVTAVHPQAFGQAIGMARKGGTIVFNGLPPGEFPAPIFEIVFKGLTIRGSLVGTRQD
LEEALDFYARGMIKPTVTECKLGDVNSVFADMHKGKVDGRMAIRY
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaccgatttccctgaggccttcaccgccgctgtagttgacaactttggccctgaa
ctcaatatccacgatgttgttttgcccgagccgggacctaatcaggcattggtaaagctg
gtggcctctggcatttgccatacagatcttcatgcggcggaaggggactggccggtaaaa
cccgagccgcctttcgtccccgggcatgaaggcgtgggggaagttgtgaaattgggaccc
ggccatcatcgcgtgcaacttggagacatggtgggcaacgtttggctttggtccgcctgt
ggggagtgcgagtactgccgcgccggacgtgaaaccctttgcaatgacgccgaatatggc
ggatatacggtcgacggttcttttggcgaatacatgctggtagatacccgctactgtgcg
cgtattccagaaggctccgatccagttgaagtggcccccatcttgtgtgccggcgtgacc
gtgtacaaaggcctcaaagaaaccgagtgtaagccggggcagtacatggtgatttccggc
atcggtggcctggggcatatcgctgtgcagtatgcggtggctatgggaatgcgagtgatc
gctgtggatattgcggatgagaaactcgagctggcgcgtaagcacggtgcagaatttgca
gtcaatgcgttgaaggaagacccggttgagtcgatcaacgcatttacctcaggtggtgcg
catggcgttttggtcactgccgtgcacccgcaggcgtttggacaagccatcgggatggcc
agaaaaggcggaaccatcgtatttaatgggcttcctccaggagagttcccggcaccgatt
tttgagattgtgttcaaggggctaactattcgcggttcattggtgggaacgcgccaggac
ctagaagaagccctggatttctatgcacgcggaatgatcaaaccgaccgttacggaatgc
aagcttggcgacgtcaacagtgtcttcgccgatatgcataaaggcaaggttgatggtcgc
atggctattaggtattaa

DBGET integrated database retrieval system