KEGG   Corynebacterium phocae: CPHO_05265Help
Entry
CPHO_05265        CDS       T05007                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cpho  Corynebacterium phocae
Pathway
cpho00010  Glycolysis / Gluconeogenesis
cpho00520  Amino sugar and nucleotide sugar metabolism
cpho01100  Metabolic pathways
cpho01110  Biosynthesis of secondary metabolites
cpho01120  Microbial metabolism in diverse environments
cpho01130  Biosynthesis of antibiotics
cpho01200  Carbon metabolism
Module
cpho_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPHO_05265
   00520 Amino sugar and nucleotide sugar metabolism
    CPHO_05265
Enzymes [BR:cpho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CPHO_05265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Band_7_C
Motif
Other DBs
NCBI-ProteinID: APT93685
UniProt: A0A1L7D6F7
LinkDB All DBs
Position
complement(1201089..1201883)
Genome map
AA seq 264 aa AA seqDB search
MTKNSSQNVSDKPRKLALGIDVGGSGIKGAVVDLETGEFATERVRIETPKPATPDAVAAT
IRKVADELGWEGPIGITLPGVVQNNRLRSAGNIDQAWLGLDLDELFARHLDGRQVAILND
ADAAGLAEVAYGEDLAKKGAVLFLTLGTGIGSAFLLDGKLFPNTELGHMLVGDMKAEHQA
SSAVREREGLSFKKWAKRLNVVLNEYSNLFNPDVFIVGGGVSRKFDKWGPLLETTTPVLP
AKLKNRAGIVGAAMAITDRIERQS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaattcttcgcagaacgtttctgacaaaccacgaaaactggcgctaggcatt
gacgtgggcgggtccggaatcaaaggggccgtggtggaccttgaaactggtgagtttgcc
accgaaagggtgcggattgaaacccccaagcccgccacgccggacgccgtggccgcaacc
atcagaaaggtcgcagatgagctggggtgggaaggccccattggcatcactcttcccggc
gtggttcaaaacaataggcttcgctccgccggcaacatcgaccaggcatggttggggctc
gacctggatgagctcttcgcccgccacttggacggccgccaggtggccatcctcaacgac
gccgacgccgccgggcttgctgaggtcgcttatggcgaagatctcgctaagaagggcgct
gtcttgttcctcactctgggcactggcattggctccgccttcctccttgacggcaagttg
ttccccaacaccgaattgggtcacatgctcgtgggtgacatgaaggcagaacaccaggct
tcctccgccgtcagggaacgtgaaggtcttagtttcaagaagtgggcaaagcggctcaac
gtggtcctcaacgagtactcaaacctgtttaacccggacgttttcattgttggcggcggg
gtttcccgcaagtttgacaagtgggggccgctacttgagaccactaccccggtgttgccc
gcgaagctgaagaaccgggcggggattgtgggtgccgccatggctatcaccgaccggatt
gaacgtcagtcctaa

DBGET integrated database retrieval system