KEGG   Corynebacterium phocae: CPHO_10175Help
Entry
CPHO_10175        CDS       T05007                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
cpho  Corynebacterium phocae
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cpho00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CPHO_10175
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CPHO_10175
Enzymes [BR:cpho01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CPHO_10175
Peptidoglycan biosynthesis and degradation proteins [BR:cpho01011]
 Precursor biosynthesis
  Racemase
   CPHO_10175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2236942..2238027)
Genome map
AA seq 361 aa AA seqDB search
MLETVIDTSAVARNVAAIKASLSPGTQLMCVVKADAYGHGVRELVPVMEAAGADALGVAT
LAEARAVKESGRTSLPVLAWIWSPEEELTPGIDLAVSSLAQAKAVSRTGFPIRVYIKVET
GMHRAGLDREEWPEVFGLLRDAPNVAVLGIMSHLACADEPGNPHNDVQAREFAAAVESAR
AAGLNCAINHLANTAATLTRPDLHFQMVRVGLGCYGLEPIEGLEHGLEPAMTWRSRVVAV
KPLKAGEGTSYGLTHCAAADGFVANVPVGYADGLPRGVQGALKVGIGGKLYEQVGRVCMD
QIVVDLGTNPHAVRAFDTAVIFGKGGMSATELANVSGTINYEIVCRPTGRTQRKYIGDSR
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaaaccgttattgacacctctgccgtcgcccgcaacgtggcggctatcaaggct
agcctttcgcctggcacacagctgatgtgcgtggtgaaggcggacgcctacgggcacggt
gtgagggaactggtgccagtaatggaggccgccggcgcagacgccttgggagtggccacg
ctggcagaagcccgcgctgtgaaggaatccgggcgcaccagcctgccggtcctggcatgg
atctggtccccggaggaagaactcacacccggtatagacctggccgtgtcctcgctggcg
caggctaaggccgtctcccgcaccggtttcccgattcgcgtctacatcaaggtagaaacc
ggcatgcaccgcgccgggttggaccgggaggagtggccggaagtattcggtctcctccgc
gacgccccgaacgtggcggtgctgggaatcatgagccatttggcctgcgcagatgagccg
ggtaacccgcacaacgacgtgcaggcccgggagtttgcggcggcggttgaaagcgcacgc
gcagccgggctgaactgcgcgataaaccacctggctaacaccgctgccaccctcacccgc
ccggatctgcacttccagatggtgcgggtggggcttggctgctacgggctggaacccatt
gaggggctagaacacgggttggaaccagccatgacctggcgctcgcgcgtggtggccgtc
aagcccctcaaggcaggggaaggcacttcttacgggctcacccactgcgccgctgcggac
ggttttgtggccaacgtgccagtgggttacgccgacggcctgccgcggggggtgcagggg
gcgctgaaagtgggcatcggcggaaagctctatgaacaggtaggccgggtgtgcatggac
cagatagtggtggacctgggcaccaacccgcacgccgtgcgcgccttcgataccgccgtc
atcttcgggaaaggtggcatgagcgccaccgaacttgccaacgtatccggaaccattaat
tatgaaattgtctgccgccccaccgggcgaacccaacggaaatatataggagacagccgt
gcttga

DBGET integrated database retrieval system