KEGG   Cnuibacter physcomitrellae: B5808_04905Help
Entry
B5808_04905       CDS       T04797                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
cphy  Cnuibacter physcomitrellae
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cphy00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    B5808_04905
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    B5808_04905
Enzymes [BR:cphy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     B5808_04905
Peptidoglycan biosynthesis and degradation proteins [BR:cphy01011]
 Precursor biosynthesis
  Racemase
   B5808_04905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1046797..1047945
Genome map
AA seq 382 aa AA seqDB search
MSETTAGRPVPGHPALRRAVVDLSAVASNVERISRIVDGAQIMAVVKADGYGHGAVPVAR
TALEAGATWLGTADVGEALAVRAQIADAPILAWLHDADPRFDEAVERGIAIGASSALHLE
RAAAAASATRARPASVHLKVDTGLGRNGIPRREWESVFDRARELELEGRVSVDGLFSHLS
NADPVEDGLQLDAFREAEGLAQAAGLEPQLRHIAATAAALRLPQTRLDLVRIGIGLYGLS
PFDDESPRRLGLRPALRLESRLISVKRVKAGTGVSYGYTYRAEQPTTLGLVPLGYADGIP
RHLSNTGSVEVGGRQRRIVGRIAMDQFVVDLGDHRASVGDLVTLFGDPATGAPSAFDWAQ
AASTINYEIVTRLGGRVVREYA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagacgacggcgggtcgacccgtccccggacaccccgcgctccgacgcgcggtc
gtcgacctgagcgcggtggcctcgaacgtcgagcggatctcgcgcatcgtcgacggcgcc
cagatcatggccgtggtgaaggccgacggatacgggcacggcgccgtcccggtcgcccgc
accgctctcgaggcgggagcgacctggctcggcacggcggacgtcggtgaggcgctcgcg
gtgcgggcgcagatcgccgacgcgccgatcctcgcctggctgcacgatgccgatccgcgc
ttcgacgaggcggtggagcgcggcatcgcgatcggagccagctccgcgctccatctcgag
cgcgccgcggcggcggcgtccgcgacccgggcgcggcccgcctccgtgcacctcaaggtc
gacacgggcctcggccgcaacggcatcccgcgccgggagtgggagagcgtgttcgaccgg
gcgcgcgagctcgagctggaggggcgggtgagcgtcgacggcctgttcagccacctctcc
aacgccgaccccgtcgaggacggtctccaactcgacgccttccgcgaggccgaggggctg
gcgcaggccgccggcctcgagccgcagctgcgtcacatcgccgcgacggcggcggcgctg
cggctgccgcagacgcgactcgacctcgtccgcatcgggatcgggctgtacgggttgtcg
ccgttcgacgacgagagccctcgccggctcggcctccggccggccctcaggctcgagtcg
aggctcatctcggtcaagcgcgtgaaggcggggaccggcgtctcctacggctacacctac
cgcgccgagcagcccaccacgctgggcctcgtgcccctcggctacgccgacggcatcccg
cgccacctgtcgaacaccggctcggtcgaggtcgggggccgacagcggcggatcgtcggc
aggatcgccatggaccagttcgtcgtcgacctcggcgaccacagggcctcggtgggggat
ctcgtgaccctcttcggcgatccggcgaccggagccccgagcgcgttcgactgggcgcag
gcggcctcgacgatcaactacgagatcgtgacccggctcggcggccgtgtggtgagggag
tacgcatga

DBGET integrated database retrieval system