KEGG   Cnuibacter physcomitrellae: B5808_14620Help
Entry
B5808_14620       CDS       T04797                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cphy  Cnuibacter physcomitrellae
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cphy00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    B5808_14620
Enzymes [BR:cphy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     B5808_14620
DNA repair and recombination proteins [BR:cphy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     B5808_14620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3126244..3128952
Genome map
AA seq 902 aa AA seqDB search
MAPKKDEQVVTVGGHRLKITNLDKVLYPETGTTKGDVLRYYSQIAPFLIPHARNRPATRK
RWVNGVGTPEDPGSVFFQKDLDAGTPDWVKRVEIEHSEGPKTYPLVNDEATLVWLAQIAA
LEVHVPQWRVDAHGRRKNPDRFVIDLDPGEGAGLPECVEVAKRARRILTDMGLDPVPVTS
GSKGIHLYAALDGKQTSDQVSAVAHELARALEADDPDLVVSDMKKSLRTGRVLVDWSQNN
ANKTTICPYSLRGRFRPTVAVPRTWRELASKDLRHLELDEVLTRMRRRVDPLAESADAPG
SVEAPGGVWHSDRGADDQAEAHPGEPDRLTVYRSKRDAAKTPEPVPEASPADTGGRSFVI
QEHHASRLHWDFRLEHDGVLVSWALPKGVPTDAGQNHLAVMTEDHPLEYGTFEGTIPEGE
YGGGTVTIWDFGTYELEKWRDDEVIATLHGQPSGGLGEPRRVALIRTGGRGGKDPKNWLI
HLMKDQHSVDWDDPASVAASKERTRGGAKRASDGGAKRDSGSGAKRESSGGSSSRENSGS
SAEKRGSGSRESSGGSAAKRESTGGTKRAAAPAAHRDLFDRTRIPSPMLATLGQATDIRD
EDEWAFEMKWDGIRALVLADHGRVALVTRNGNDVTAAYPELVEELAAATADRELLLDAEV
VALDAKGRPSFGRLQQRMGLSKPREVEAAARRVRVDLMVFDLLEEDGESLVDEPYDERRR
RLEDALPASSGRLHVPPAFDGDLDHALTSSRELGLEGVMAKRRASTYTARRTRDWIKLKH
HLAQEVVIGGWRPGNGRRASQVGSLLLGVPDAEGGLRYVGRVGTGFTDRQLADIAAKLAP
LARKTSPFVDVPRPDARDAQWVTPKLVGEVEFAEWTGDDRLRQPSWRGWRTDKEPSDVVR
EG
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atggccccgaagaaggacgagcaggtggtcacggtcggtgggcaccggctgaagatcacg
aacctcgacaaggtgctctaccccgagaccgggacgacgaagggcgacgtgctgcggtac
tactcgcagatcgcgcccttcctcatcccgcacgcgcgcaaccggccggccacgcgcaag
cggtgggtgaacggggtcgggacgcccgaggacccggggtcggtgttcttccagaaggac
ctcgacgcggggacgcccgactgggtcaagcgggtggagatcgagcactccgagggcccg
aagacctatccgctcgtcaacgacgaggccacgctcgtctggctcgcccagatcgcggcg
ctcgaggtgcacgtgccccagtggcgggtggatgcgcacggccgccgcaagaaccccgac
cggttcgtcatcgaccttgaccccggcgagggcgcgggcctgcccgagtgcgtcgaggtg
gccaagcgcgcccgccgcatcctgaccgacatggggctcgacccggtccccgtcacgagc
ggcagcaagggcatccacctctacgccgccctcgacggcaagcagacgtccgatcaggtg
tcggcggtggctcacgagctcgcgcgcgccctcgaggcggacgaccccgacctcgtcgtc
agcgacatgaagaagtcgctgcgcaccggcagggtgctcgtcgactggagccagaacaac
gccaacaagacgaccatctgcccctactcgctgcgaggacgcttccgccccacggtcgcc
gtgccgcgcacctggcgggagctggcctcgaaggacctccgccacctcgagctcgacgag
gtgctgacgcggatgcggcgacgcgtcgatccactcgccgaaagcgccgacgcgcccggt
tcggtggaggcgccgggcggcgtgtggcactcggaccgcggggccgacgaccaggccgag
gcgcatccgggcgaacccgacaggctgactgtgtaccgatcgaagcgcgatgcggcgaag
acgcccgagccggtgcccgaggcgtcgcccgccgacaccggcgggcggtcgttcgtgatc
caggagcaccacgcctcgcggctgcactgggacttccgcctcgagcacgacggcgtgctg
gtgtcgtgggcgctgcccaagggggtgccgacggatgcgggccagaaccacctcgccgtg
atgacggaggaccatccgctcgagtacggcaccttcgagggcaccatccccgagggcgag
tacggcggcgggacggtcaccatctgggacttcggcacctacgagctggagaagtggcgc
gacgacgaggtgatcgccacgctccacggccagccgtcgggcggtctgggcgaaccccgg
agggtggcgctcatccgcaccggcggccgcggagggaaggatccgaagaactggctgatc
cacctcatgaaggatcagcacagcgtggactgggacgacccggcctcggtcgccgcgtcg
aaggagcgcacgcgcggcggcgcgaaacgcgccagcgacggcggcgcgaagcgcgacagc
ggcagcggcgcgaagcgcgagagcagcggcggcagcagctcgcgcgagaacagcggcagc
agcgccgagaagcggggcagcggctcgcgcgagagcagcggcggcagcgccgcgaagcgc
gagagcaccggcggcacgaagcgcgcggccgcgcccgccgctcaccgcgacctcttcgac
cgcacgcgcatcccttcgcccatgctcgccaccctcggccaggccaccgacatccgcgat
gaggacgagtgggcgttcgagatgaagtgggacggcatccgcgccctggtgctcgccgac
cacggcagggtggccctcgtgacccgcaacggcaacgacgtcaccgccgcctaccccgag
ctcgtcgaggagctcgcggcggccaccgccgaccgcgagctgctcctcgacgccgaggtc
gtggccctcgacgcgaagggccgcccgagcttcggccgcctgcagcagcggatggggttg
agcaagccgcgcgaggtcgaggcggcggccaggagggtcagggtcgacctcatggtcttc
gacctcctcgaggaggacggcgaatccctcgtcgacgagccctacgacgagcggcggcgg
cggctcgaggacgccctgcccgcctcctccggacgtctgcacgtgcctccggccttcgac
ggcgatctcgaccacgccctcacgtcgagccgggagctgggcctcgagggcgtgatggcg
aagcgccgggccagcacgtacaccgcccgccggacgcgcgactggatcaagctcaagcac
cacctcgcccaggaggtcgtgatcgggggctggcgccccggcaacggacggcgggcgtcg
caggtggggtcgctgctgctcggggtcccggatgcggagggcggcctgcggtacgtcggt
cgtgtcggcacggggttcaccgatcgtcaactcgccgacatcgcggcgaagctcgccccg
ctcgcgcggaagacctcccccttcgtcgacgtgccccgtcccgacgcgcgtgacgcccag
tgggtgacgccgaaactcgtcggagaggtcgagttcgcggagtggacgggcgacgaccgt
ctgcgtcagccgtcctggcgcggctggcgcaccgacaaggaaccctcggacgtcgtccgc
gaggggtga

DBGET integrated database retrieval system