KEGG   Chitinophaga pinensis: Cpin_0998Help
Entry
Cpin_0998         CDS       T00959                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cpi  Chitinophaga pinensis
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Cpin_0998
Enzymes [BR:cpi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Cpin_0998
DNA repair and recombination proteins [BR:cpi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Cpin_0998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1198371..1200956
Genome map
AA seq 861 aa AA seqDB search
MSSLKTYDEKRDFKQTAEPKGAKKKSGGKQHIFVIQRHHASRLHYDFRLEVDGVLKSWAV
PKGPSMNPADKRLAMQVEDHPYDYKDFEGVIPEGNYGAGYVYVWDKGNYELLREDGSSFD
KEANKEIREGDLKIRLKGRKVKGEFALVKMKNSEDNAWLLLKHKDDYAVKDAYNSEDFTP
QRVKDRGVKEKEKMKGAGKKKAGLTKVKTAPQTEKTVKKNKRQQELFTPMMATLVDAPFS
REGWLFETKWDGYRAIADVRKGKVELYSRNHLSFNKDYAPVVKALESLQHDAVLDGEIVI
LKKDGTSDFQSLQNYKNDPSGNLVYVVFDLLELDGEDLKAMPLIQRKELLKTVVKQLKRK
DVIYSDHVMDNSDALYKQAKEKGWEGIIAKEADSLYAEGKRAMAWLKIKIIDEQEAIICG
YTDPKGSRKKIGSLVLGVYDDKQQLRYVGNCGGGLNGALINELYEKMQPLRQKTSPFDKK
IRTNTPVTWVKPQLVCQVKFSSWTSDKQLRQPVFLGLRKDKPAEEVHQETAKPTKMATKK
AAATAAPVKATPEKERVVTLNSKKVPLTNQQKLYWPDEKVTKGDLIDYYMDMADYVLPYL
KDRPLSLHRFPNGIKDAGFYQKDVDTESAPDWVKTVTLHAASASRDVDYLVCNNAATLVY
MANLGCIEMNPWLSRVKNLDHPDYIVLDLDPENIAFKYVVETALAIKELLDKVGVKSFCK
TSGASGLHIYVPTGGKYNYETCRLFAEYVAKQVQQELPKITNVIRTKSKRNKKVYIDYMQ
NSRGQTVASPYSVRPKPGATVSAPLDWKELNDDLAISNFTMENMRDRIRAVGDLWKDIDK
TKNDLRKAIEKVESIAAAHVE
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcttaaaaacatatgatgaaaaacgggatttcaaacagactgcggaacctaaa
ggtgcgaagaaaaagagtggtggaaagcaacacatttttgtcatacaaaggcatcatgca
tcacgtctgcattatgacttccgtttggaggtagatggagtgctgaaaagctgggcggtg
ccaaagggaccttctatgaatcctgcggataagagactggccatgcaggtggaagatcac
ccatatgactataaagattttgaaggtgtgatcccggaagggaattacggcgctggttat
gtctatgtctgggataaaggcaattacgaattactgcgggaggatggtagcagctttgat
aaagaggcaaataaagagatcagagaaggggatctgaaaatacgcctgaaagggcggaaa
gtgaaaggggagtttgcattggtgaagatgaagaattcggaggataatgcctggctgtta
ctgaaacacaaagatgactatgccgtaaaggacgcttataatagtgaagatttcacgccg
cagcgcgtaaaggaccggggcgtgaaggaaaaagaaaaaatgaaaggcgcaggtaaaaaa
aaagcaggtctcacaaaagtgaaaacagcgcctcaaacagaaaaaacagtaaaaaaaaat
aaacggcagcaggagctttttacaccgatgatggccaccctggtagacgctcctttcagc
cgggaaggctggttgtttgaaacgaaatgggatggttaccgggctatagcagatgtaagg
aaaggcaaagtggaactatactccaggaatcatctctccttcaataaggattacgcccct
gttgtaaaagctttggaaagtctgcagcatgacgctgtgctggacggagaaatcgttatc
ctgaaaaaagacggtacttccgatttccagtcgttacagaattataagaatgatccttct
ggcaatctggtgtatgtggtgtttgatctgcttgagttggatggagaagacctgaaagct
atgccgttgatccagcgaaaagaattgttgaaaacggtggtgaagcagttgaagcgtaag
gacgtcatttattcggatcatgttatggacaatagtgacgcattgtataaacaggcgaag
gagaaaggctgggaaggaatcattgcaaaggaagcagatagtctgtatgcagaagggaaa
cgtgcgatggcctggctgaagataaagatcatcgatgaacaggaagcgattatctgtgga
tatactgatcctaaggggagcagaaagaagatcggttccctggtactgggtgtatatgat
gataagcagcaattgcgatatgtggggaactgtggcggtggattaaacggggcattgatc
aacgaactatatgagaagatgcaaccactgcggcaaaaaacatcgccttttgataaaaag
atcaggacaaatacaccggttacctgggtaaaaccgcagctggtatgccaggtgaagttc
tcttcgtggacaagtgacaagcagctacggcagccggtattccttggattgaggaaagac
aaaccggcggaggaggtgcatcaggaaactgcaaaacctacaaagatggctactaaaaaa
gcggcagcaaccgctgctccggtgaaagctacccctgagaaagagcgggtagtgacactc
aacagtaaaaaggtaccgctgaccaatcagcagaaattatactggcccgatgaaaaggtg
acaaaaggtgacctgatcgattattatatggatatggcggattatgtgctgccttatctg
aaagacagaccactcagcctgcatcgtttcccgaatgggatcaaagacgcaggtttttat
cagaaagatgtagatacggaatccgctcctgactgggtgaaaacagtcaccttacatgcg
gcttctgcatcccgggatgtggattacctggtttgtaacaatgctgctacactggtctat
atggccaaccttggctgtattgaaatgaatccctggttatcgcgtgtgaaaaatctggat
catccggattacatcgtactggacctggatccggagaatattgcttttaagtacgtggtg
gaaaccgcattggcgataaaggaactattggataaggtaggtgtaaagtctttttgtaag
acgtccggggcttcgggattgcatatttatgtgcctaccggcggaaaatataattatgaa
acctgccggttatttgcggaatatgtggccaagcaggtgcaacaggaattaccgaagatt
accaatgtgatccgtacgaagtctaaacgtaataagaaggtttatatcgactatatgcag
aatagtcgcgggcagactgttgcttcaccttattccgtaaggccgaaaccgggagctacc
gtgtctgctccgctggactggaaggaattgaatgacgatcttgctatcagtaattttacg
atggagaatatgcgggatagaataagagccgtgggggatttgtggaaagatatcgataag
acgaaaaatgacctgcgcaaggcgatagaaaaagtggagtcgatagcagcagcgcatgtg
gaataa

DBGET integrated database retrieval system