KEGG   Chitinophaga pinensis: Cpin_3399Help
Entry
Cpin_3399         CDS       T00959                                 

Definition
(GenBank) amino acid adenylation domain protein
Organism
cpi  Chitinophaga pinensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
4167577..4188945
Genome map
AA seq 7122 aa AA seqDB search
MSFSSINSLVEILFDSSAGKSTGITFITGQDKEEFLSYKELKAQAAFVLYNLRKTGLQAG
DELIIQLEDNKSFLLIFWACLIGKIIPVPLSFGGQEEYKHKLFAVWRTLRHPFLITTADQ
LKRMSEFADDQAGAATYAEMVAACVPLDAITIREQCATELPVISRKDIAYIQYSSGSTGN
PKGVILTHENLLYNARDIVMRSGTSAQDKSLSWMPLTHDMGMICFHLSSLFAGIDQYLLP
TPLFIRRPSLWLSKASQHGISQLYSPNFGYQYFLAAFSREEATSIGMDLSSIRIIYNGAE
PIDAAICRNFQHTLAPYGLPERVCYPGYGLAEASVAVTLPIPGDELTVYYLDRENLSVGN
QVRELDPHDKSAVSFVEVGLPIDHCNIRIAGPKDEWLGDDTVGNIQIKGLNVTAGYYMQD
DVTRQLYTKDGWLRTGDIGFVRNRRLVITGRAKNMMIVNGQNYYPHDIERVVQTIPGMEL
GKVVACAIKQADEKNDALVLFILHKGALEPFAELAAAAQKRILEATGLGVESFVPIKKVP
KTTSGKVQHFRLIEQFRSGYWDKTLAELKALSAPASAAVGATAEVIAAAWLEVSGQQLTN
PQQSMLDASLNSLLIMRFIAIVSEKLSRKLTIKDFFEHPTVAALEAFLEAAPQQEINTCL
LPYAAEEAHTVTLTQQRFFMMEMLQPENSPLNISYTLLVEDDISPAVLEAASAELARRHD
VLRSFFRLTDAGPRQYFNRDASVSFLYNDLSSASNPLAASQEACKAFSRMPFDLESAPLW
RIGLFKVAPGKSMICVVMHHIISDGWTLLLIKNELAAIYRMLLGEQVQLPQTTDFRAYTS
WYASWLSGAQYLADKQYWLHEYAGFEQTALFQLPQGMEQHGKDFAASRVSFELDAATYER
LQQHCKEQQVSVFAALITLISAWLYKFTGRTDIAIGTDSSGRLAAGLEGIAGCFINTMVI
RNRFTADNSLGWLLSYTAGKIFDAFEHQLYPADMKQENAAEAPVMDVLVLFQNFGLTTYD
NFGNAKAQLIELPAETSLAALSFEFIEEADTLRCHIDFRTSLFSRSQAAWWPGHFNMLLT
ALLDTPAARLNSVNMLVTEEKVLLAKRHNDLYYSHIYVENDIIRRFERMTAQTPQATAVL
FEGKYISYEELNAQVNQWAYFLKAAHGIGYGDRVGICLPRSDKSLIAILAILKTGASYVP
LEQEYPTNRLQFMIADSGLTLLLSDAACEHDFSSSQATQLVWEEIAAQLTDYPTDNPGTI
VRDIDEAYVIYTSGTTGRPKGVSVNRLALYDYAQTVVVYFGITDTDIVIQQSALSFDTLL
EEIFPALCQGAAIHILRDGGRDIEAILYAIDTGKATILSTTPAVIAELNRYAGVMTGLRV
LISGGEMLKYTQIDQLLKEGVNIYNTYGPSETTVCATYHKVVPGTGNIPVGRAIRNRKVY
LLDEDKCMVPAGAVGEIYIGGLGVADRYVNQSELTAKSFFEDTVSRFGKMYRTGDLGRWR
EDGTLEFLGRKDQQVKINGYRIETGEIEAQLAEHPAVGEAVVVARKNGVGKDMLVCYYTV
QGNISLSALKAFSKERLPFYMVPAAWAQLDILPLTGNGKVDRKALSALAVDTSDNTQPDV
LPGNEWEASLLEGWTNILDTPVSSITANFFEQGGNSLMATRLILWIEKKYALRLTLRDVF
SNPTVQEQARLIATLSHQQTGIYEPIPVLTTAPHYPASFSQKRLWLLDNFDENKGAYNLS
WAFVIEGPFNYNAFSQALGWLVSRHEALRTNFAFIDGSLTQVIRDGKAFQVDFLDYSNDP
EAIEKVRDYVKETAVYPFDLQSASLLKATIIQLNDGVALFVLALHHIIGDAWSMDLISDE
LSLAYNAFAAGTKPDLPALQIQYKDFAAWQQTKLDGEEINASKQYWLNRFKGDIPVLQLP
EDNTRPALQTYNGQTVHINIDSALQQQLNDLTTAHRCGLYVVLLASVKAFLSRISGQTDI
VIGAPVSGRLHPDLVSQVGFYVNTLPLRTTFAEDHSFDALIDNVQQTFLDAFEHQDYPLD
LLVEELDIVRDESRTPLFNVMVDFLDTKTTVKKPLELDQLILSPFPVDKEASQFDLSFDF
TAAEGQLSLYLNFNTDIFREDSIRILLSRYLQQLQNMAFNSAAAINKQTYLPAEEQARVL
AFAGKGQAKLPATDLVTLFESKAQQYGHLPAVHCEDFSLSYSALNELSNRLADCLVKEFG
VLPGDRVGIMVGRNEWMVVSVLAVLKAGAAYIPMDPEYAAERVNHMIADSGVTVLLTELD
ELPVTVDNMRILNLAIFESMADQYSELNPVVKPATDDLAYLVYTSGSTGLPKGAMITHRH
LLGLWDSLETAYDLNTFEVRLLQVASISFDVFFGDMLRSIFRGGLMVICPAEHRYNLPAL
YELMHSYRITVMESTPGLLLPLLDYMYEEGARLDFMRIFILGSDTLSVEDYRKIYDRFSH
SELRIINSYGTTETTIDSSFYEGLGIDLRSTGYVPVGRPLENTRMYVLDKEMQLCGIGVA
GELCIGGLGVGLGYWNRPELTTERFVTDPYVSGGRMYRTGDLARWNAAGNLEFLGRGDNQ
VKIRGYRIEPGEVESVLLAYSGVQEAVVLAYNVSDREKELVSYIVWQEAADEEGLRSWLR
EQLPQYMHPAYYITLEAMPLTSNGKVDRKQLPAPTLNVNRAYEGPRNKVEATLVGIWEEV
LQKQPISIHDNFFELGGHSLKGMRALWRIRKELGVELSFRDMFSYPRITELSALLNRQTA
SQGTAYPLVAVAKQASYELSHAQRRLWLLDQLEEQGRSYTMPVQYRVKGTLHTALLEKAF
NVLIARHEILRTIFITEEGNPRQQILADAKIVLETADLKGRADKGEALSTYVNRIHQAVF
NLSAFPLLQAGLFQVEEEEYVFAFNMHHIISDEWSIEVMVEELVTIYDQLNSGEAIDLPA
LPVQYKDYSVWQQAQLQGSQLETAAAYWRNQFADSIPVLDLPADHPRPAVKRYEGRTLRM
ELNKEQLEGLYEVGRRNEASLYMTLLASVKGLLYRYTGQSDIVIGSPVAGRSHELLARQL
GFYVNTLALRTQFDANDSFDGLLQSVRDVVLGGFEHQDYPFDLLVEELDVQRDISRSPLF
DTMVVLQGRDYQGMTQQTWENGLQWEETSTDAGVSKFDLTLLFREHEEGIQVEVEYNTQL
FSAARMERFCAHYDNFVNGIVADSTNAIAEITYLSIEEQHRLLDVFNDTGNDAYPSERTI
HSLFEENALHMGSRTAVVYEDRTLTYAALNSAANKVADYLRREHGVESGDLVGLMVERSE
KLIICLLGILKAGAAYVPVDPAYPAARISYMLEDSTPRVVLTDSLAAVALSTGNDLGNVP
TEGDGTSLAYMIYTSGSTGQPKGAMIAHHAVINLSYWLRELIYIQYPDGLVAMLTASINF
DASVQQLFAPLLSGSQLVIISEADRRQIERYVAQLKKNHVAVIDITPGYLRVLMDVLKVT
GTDGLQLKYILVGGEALPAEDRALFHEIFGNTVHLINVYGVTEATVDSTYEIVTADDNNG
LSIGRPLKNTRMYVLDKNLQLCAYGVTGELCIGGAGVGLGYWNRPELTAERFITDPYLAG
GRIYRTGDLARWTSAGNIEYLGRGDNQVKIRGYRIEPGEVENVLGAYSGIREAVVLAYSV
SDREKELVSYIVWQEGADEEGLRNWLREKLPQYMHPAYYITLDAMPLTSNGKVDRKQLPA
PVLNANCTYEGPRNKVEETLVSIWEEVLQKHPISIHDNFFDLGGHSLKGMRALWRIRQEL
GVELSFRDMFTYPRITELSALLGSQATSAVTAKPLVAVEEQSSYELSHAQRRLWLLDQLE
EQGRSYTMPVEYRVKGALDAGVLEDAFNALIARHEILRTIFITEDGHPRQQVLAEAKIAL
DYADLKARTDKGEALSAYVTRIHQAVFKLSGFPLLQAGLYKVEEAEYVFVLNMHHIISDE
WSAEVMVEELVSIYDQLSNGQSIELPALPVQYKDYSAWQQAQLQGGQLETAGAYWRNQFA
DGIPVLDLPVDNSRPAVKTYAGQTLRMELNKTQLAGLYETGRRNEASLYMTLLASVKGLL
YRYTGQSDIVIGSPVAGRNHELLARQLGFYVNTLALRTQFDGRDSFDRLLQAVRQVVLGG
FEHQDYPFDRLVEELDVQRDMSRSPLFDVMLVLQDRDARGVSQQFRSNALQWEEVNMDTA
VSKFDLTLIFKEHAAGISIEIEYNTRLFSAERIARFASHYSEFVNEIVADSSIALADISY
LSAEELNRVLHTFNHTGSSVYPADRSIHSLFEEKALRMGESIAVVYEDRQLTYAALNSAA
NKIADYLRREHGVVNGDLVGVMMERSEQLIVCLLGILKAGAAYVPIDPSYPASRISYMLE
DSLPRVVLTAALAAAALSNGVDNGNVDTANDANALAYIIYTSGSTGKPKGVMVPHIGVVR
LVYAPNYVTFSEEDRLLQTGSVSFDASTFEIWGMLLNGGTLYLLDHDKLMDADILKDTIQ
QHNITMMWFSAPWFNQLVDNDPSLFEGLKDILVGGDKLSPAHINAVLSLYPDINIINGYG
PTENTTFSICYPIREAQTGAIPLGYPVSGTQVYILDKQFRPLPVGSYGELYLAGDGLATG
YLNMDDRNRERFVDNPFKPGTRMYSTGDIGRWNNKGEVEFTGRTDDQVKIRGFRIEPGEI
ADAILEHTAVKDAVVIPFTTAAGEKELAAYVVWTAATATAALQSFLRDRLPSYMQPGCYI
DMEVLPLNANGKVDRDGLPAPQLELTAALEAPRNATETALLSIWKTILQREDIGIYDNFF
DKGGHSLRASRLLAGIHKELNVKLSLKTLFLHNTIAALSEVIAAADKVSYEALTPVAEQV
HYNVSHAQKRLWILDQMESNTSAYNIPGAYNIEGQLDKTILDAALNILLGRHESLRTIFI
KSAGEPKQQVLAADKVKAQIAYHDLREDANKEATAEQLLHAAMHNGFALHTWPLFRASLI
QLEAERYIFVFCIHHIISDGWSQGVIGKEISAIYNALIAGRTPELSTLSVQYKDYTGWHS
RLLEGQFGEEAKHYWSKRFDKPAPWLNMPADRLRPRLQTFDGDVVKCRFGTAVTTRLQQF
SREQDATLFMSLLALVNTLLYRYTGIDDIVITSPIAAREHADLNDQIGFFANTLPLRTRF
SDEQSFEALLQEVKDTTVAAYRYQMYPYDMVIEDATQQYDPSHAALSDVMLVLQSNESTS
LDLQGTVTAALDLSTNTARFDLVFIFTMEEGELCLDLGFNTNIYDRARIVSISQALTVLT
NNMLSAPAITVKELAVKDIPADEVSDKDIPMAIMNGHLVYAAEVNAALETLPGIIAANAQ
VTEENTLDVFITPGGEEGHTIARLLNIALDEHREDKQVYTLPNGLPICYKNKTETDFTYH
EVFEQHAYLRNDITIHPGDVIFDVGANIGMFSMYAGHHFPGCRVFAFEPIPPIYNCLAAN
AAMYNLGITAMNMGLSTEETTAEFVYYPNNTIISGRFGDAIEDKEVVRRYLQNKLDSEGS
TMSEKHMEEILEDMIRSEKWECRLSTVSNVMREQGVEWIDLLKVDVEKSEWDILQGIEAA
DWKRIRQVIVEVHDTDGRLERITRLLEEHGFGVYVEQEEELAGTALYNIYAIHHQHQRAA
ATPAAVKPGWNDVAAYYTHINGMIHDRLPAYLGNVNVYLTDYTNAIQKRRIDAVKTYNAT
LKGVPAAQPTSLQLVVAATFTADPLSDYITWWTDRFSIPVQVKLAPYNQVFQELLNDDSL
SARNKDINLLLVRWEDWIRDARGTAAEQRQLVTQSLEQLISVLQSAQRQALYMVGVIPPV
AAACPDTEMFLFLEQINYRWTAALAGMDHVHTLDLSSIGERFGIAELYDTQRDKLGHIPF
QEEVYAAVATMVARQIRAYKQPSFKLIVLDCDNTLWSGVVGEDGVNGIQLLPEHIALQRF
MKQKKEEGFLLALSSKNNEADVWEVFEQRTDMVLRKDDFVTWRINWNNKAANIQEIVTEL
NIGINACCFIDDSPVECTAVTAAHPEVLVLQLPEETSFIPRWLSHIWAFDKFTVTEEDRK
RTEMYQAEKERRNILEAQPTIGDFLAQLQLQIIVQDVQEADIPRVAQLTERTNQFNLNGQ
KKTAHEIEAYMLGGARHCKTIRVTDKFGDYGLTGALITTIQEDSLLVDTFLLSCRVLGRQ
VEQSMLAVLKEQAQAAGLQKIVCHFTDTGKNKPFAQFLASTSWTAVQTEGKSTFYEILPE
NIVAVLPVLTSAAPPEPVATTTEESTVLVFDHIGVAVSDLEASLRFYTDSGFTASELVYD
PIQNVEIYMCRTASGGGIELIAAHDELSPVNNIISRNGDQPYHWCYRVKDIDTLFDRLTR
KGLAFEIVKQPEQAVLFGYKRVVFIDIKQIGLVEFIEDNDSLPGQLLPAEMEISMVTFDI
QPALQFFQLVGYRETRHITDHVNKEYVVVLHTAANGPAIRLIMPLPEAVAERAAFLQQNG
PHIHRLLLHTDTTEKYPMHLLPPYFTVEEEHKTVLTDVADWEPVLAMEKDATHYALQLPL
LYNSGARLLQIPVYQVQKQRMNTGMRPPETTVEKALFRIWVEVLRHEAFGVQTSFLEAGG
NSIRATQILSRIYRQYGVELLLTEFFNKPTISALAALIEKKQPEGFESIRVLPAMEHYPL
SFSQKQLWISDQFESSSGSAFNIPVAYILEGQLDKTALTKAFSRLVERHEILRTVFVKAG
DEAAQQVLPATDDYSTPEWIDLSTTPDAEAAAMKIADEEAQVAFNLETGPLLRIKVLQLS
AERNLLLFTTHHIVSDGWSSGIMLREVAVFYNAIRNGRNLVLPALPVQYKDYAAWQQEQM
QRPAFAAHRQYWLSQFQDGVPALQLPYDFPRPSFKSYNGNTRSFILDKTQTAKIKTFMEQ
QEISLFMFFVSVTKLLLYRLSGQQELVVGFPVSGRYHPELEDQVGCYVNTIALRSKLDTQ
SSLQDFVHEIRQSITHAYTHAAYPFERLVEELGGHTDLSRSPLFDVMVQIQDAHMVHQQD
AAALEGLSIHMADQQLAFSKYDLTVNVMETDDGISIDLEYNTDLFKPDTINTIQADCIRL
IHILLTESVRTLGETRMLLAAGSGNLMQQYQQAFTASIDESF
NT seq 21369 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcagcagcatcaattccctggttgaaatattgttcgatagtagtgccggaaaa
agtacaggtattacttttatcaccggtcaggataaagaggaattcctgtcatataaagaa
ctgaaagcgcaggcagcattcgtactgtataacctgcgtaaaacaggtttacaggcaggg
gatgaactgatcattcagttagaggataataaatccttcctgcttatattctgggcctgc
ctcattggtaaaatcattccggtgcccctttctttcggtggacaggaagaatataaacac
aagctattcgccgtatggcgcacactcagacaccctttcctgatcacaactgctgatcag
ctgaaaaggatgtctgaatttgcagatgaccaggcaggcgccgctacctatgcagaaatg
gtcgccgcctgtgtaccgcttgatgctattactatacgggaacaatgtgcaacagaactg
cccgttatcagcagaaaagatattgcctatattcaatattcttccggttccacaggtaat
cccaaaggtgtaatactgacgcacgagaacctcttatataatgcgcgtgatatcgtgatg
cgttccggcacctccgcccaggataaaagcctgagctggatgccgctcacacatgatatg
ggtatgatctgctttcacctgtcatctctttttgcagggattgatcagtatctgctgcct
acgccgcttttcatcagaagaccttcgctgtggttatccaaagcttctcagcatgggata
tcacagctgtattctcctaacttcggttaccagtatttcctggcggctttctccagagag
gaagctaccagtattggtatggacctttcatccatcaggatcatctacaatggcgctgaa
ccaatagacgctgctatctgtcgtaacttccagcatacactggcgccttatggtctgccg
gaaagagtatgttatccgggttacggtctcgcagaagcttctgtggccgttacattacct
atacctggtgatgaactgactgtttattacctggacagagaaaacctcagtgtcggcaat
caggtgcgcgagctggatccacacgataaaagcgccgtaagttttgttgaagtaggttta
cccatagaccactgtaatatcaggattgccggtcctaaagatgaatggctgggcgatgat
accgttggcaatattcagatcaaagggctcaatgtaaccgccggctattatatgcaggat
gatgtaacccgtcagctgtatacaaaagatggctggctgcgtaccggcgatattggcttt
gtacgcaacaggagactcgtaatcactggtcgtgcaaagaatatgatgatcgtaaatggt
cagaattattatccgcacgatatcgaaagagtcgtgcagaccattcccggtatggaattg
ggtaaagtggtggcgtgcgccatcaaacaggctgacgagaagaatgatgcgttggtactg
tttatcctgcataaaggcgccttggaaccattcgcagaactggctgctgctgcacagaaa
agaatactggaagcaaccggactcggtgtagaaagtttcgtgcctatcaagaaagtacct
aaaaccaccagtggtaaagtacagcacttccgtctgatagaacagttccgttccggttac
tgggataaaacgctggcagaattaaaagcactatccgcacctgcatcagcagctgtagga
gccacggcagaagtgattgccgcagcatggctggaagtgagtggtcagcagctgacaaac
cctcagcagtctatgctggatgccagtctgaacagtctgctgattatgcgctttattgcg
attgtcagcgaaaagctgtccaggaaactgacgattaaagactttttcgaacatcctact
gtagctgccctggaagcattcctggaagccgctccacagcaggaaataaatacctgtctg
ctgccatacgcagcagaagaggcacacacggttaccctgacccagcaacgcttctttatg
atggaaatgttacagccggagaatagcccgctgaacatttcttacacactgctggtagaa
gacgatatcagccccgccgtactggaagctgcatccgcagaactggcccgcagacatgac
gtgctgcgttccttcttccgcctcacagatgccggtccccgacagtattttaacagagac
gcttccgttagttttctatacaatgatctgtcatcagccagcaacccactggctgcttca
caggaggcatgtaaggcattcagccgcatgcctttcgacctggaaagtgcacccctgtgg
cgcataggtctgtttaaagtagcgccaggtaaaagcatgatatgtgtggtgatgcaccac
attatcagcgacggctggacattactgctgatcaaaaatgaactggcagctatttacaga
atgttacttggtgagcaggtacaattgccgcagaccactgatttcagggcatacaccagc
tggtacgcatcctggttgtcaggtgcacaatatctggcggataaacaatattggctgcat
gagtatgccggtttcgaacagaccgctttattccagttgccacaaggtatggagcagcat
ggaaaagacttcgctgccagccgtgtttcttttgaactagatgcagctacttatgaaaga
cttcagcagcattgtaaagaacaacaggtatccgtatttgcagcgttgattacgctgatc
agtgcctggttgtataaatttaccggtcgcacagatattgcgattggaacagatagcagc
ggccgactggcagccggactggaaggtatagccggttgctttatcaatacgatggtaatc
aggaaccgttttactgcagataatagtcttggctggctgctgtcttataccgcaggaaaa
atattcgacgccttcgaacaccagctgtatccggctgatatgaagcaggaaaatgcagca
gaagcaccggtgatggatgtactggtactattccagaacttcggattgactacctacgat
aatttcggcaatgcaaaagcacagctgatagaactgcctgctgaaacttcactggccgca
ttgtctttcgaattcatcgaagaagccgatacactgcgttgccatattgatttcagaaca
tccttattctcccgctctcaggcagcctggtggccaggtcatttcaatatgctgttaacg
gcattactggacacacctgctgcaagattgaacagcgtcaatatgctggtaacggaagaa
aaagtattgctggcgaaacgtcataacgacctgtattattctcacatctatgtggaaaat
gatatcatcagacgctttgagcgcatgacagcgcaaacgccacaggcaacagcggtactg
tttgaaggtaaatatatctcttacgaagaactgaacgcccaggtaaaccaatgggcttat
tttctgaaagcagcacatggtataggttatggcgacagagtgggtatttgtttacctcgt
tctgataaatcactgatcgctatactggcgatattgaaaacaggcgcttcctatgtgcca
ctggaacaagagtatcctaccaaccgtctgcagtttatgattgcagacagcggactgaca
ttattgctgtcagatgctgcctgtgaacatgatttcagcagcagccaggccacacagctg
gtatgggaagagatagctgctcagttgactgattatcctacagataatccgggtacgatc
gtacgtgatatagatgaagcatatgtgatctatacttccggtaccaccggccgtccgaaa
ggggtgtctgtcaacagactggccttatatgattacgcacagaccgtagtggtgtatttc
ggtatcacagatacagatatcgttatacagcagtctgcgttgtcctttgatacactgttg
gaggaaatattccctgcactttgccagggtgctgctatacacatattgagagatggcggt
cgtgatatcgaagcgatcctgtatgccatagacacaggcaaagccactattctcagtacg
acgcctgctgtcatcgcagaactgaacagatatgcgggtgtaatgacaggactgagagtt
ctgataagtggtggtgaaatgctgaaatatacacaaatagaccagttgctgaaagaaggc
gtaaatatatacaatacctacggtccttcagaaacgactgtttgcgccacttaccataaa
gtagtaccgggtacaggtaatattcctgttggccgtgctatccgtaacagaaaagtatac
ttgctggatgaagataaatgcatggtgcctgccggcgctgtaggcgaaatttatattggt
ggtctgggtgtagcagatagatatgtaaatcagtcggaactgactgctaagagcttcttt
gaagataccgtcagccgttttggtaagatgtatcgtacaggagatcttggccgttggaga
gaagatggcaccctggaattcctgggtcgtaaagaccagcaggtgaagatcaatggttat
cgtattgaaacaggagagattgaagcacagctggcagaacatcctgctgttggtgaggct
gttgtagtagcgcgtaaaaatggtgttggcaaagacatgctggtatgctactatactgta
cagggaaatatcagcctctctgcattgaaggctttttccaaagaacgcctgccgttctat
atggttcctgctgcctgggcacaattagatattttaccgctgacaggcaatggaaaagta
gaccgtaaagcactgtctgcattagcagtagataccagcgataacacgcagccggatgta
ttaccgggtaacgaatgggaagcctctttactggaaggatggacaaacatcctggataca
ccggtaagcagcattacggctaacttctttgaacagggtggtaactccctgatggcgacc
cgcctcatactatggatagaaaaaaaatatgcactacggctcaccctgcgggatgtattc
agcaatcctacggtacaggaacaggccagactgatagctactttaagtcaccagcagacc
ggtatctacgaaccgatacccgtattgactactgctcctcattatccggcctccttcagt
cagaaacgtttgtggctgctggacaattttgatgaaaataaaggtgcttacaatctcagc
tgggccttcgtgatagaaggtccttttaattataatgcgttttcgcaggctttaggctgg
ctggtaagccggcatgaagcgctgcggaccaactttgcattcattgatggtagtctgaca
caagtgatcagagacggcaaggcattccaggtagacttccttgattacagcaatgacccg
gaagcaattgaaaaagtacgtgactatgtaaaagaaacagccgtttatccattcgacctg
caatcagcttccttactgaaagccaccattattcagctgaatgacggcgtagcgctcttc
gtactggccctgcatcatattattggagatgcctggtcaatggatctgatctctgacgag
ctgtctctcgcttacaatgcatttgcagcgggtacgaaacctgatctgcctgcattacag
atacaatacaaagacttcgccgcatggcaacaaacgaaactggacggcgaggaaatcaat
gcttcaaagcaatactggctgaaccgctttaaaggagatattcctgtattgcaactgccg
gaagataataccagacctgcactgcagacttacaacggacagacagtacatatcaatatt
gacagcgctttacagcaacagctgaacgacctgaccactgcacacagatgtggtttgtat
gtagtactgctggcttctgtaaaagcgttcctgtcccgcatcagtggtcagaccgacatc
gtgattggtgcccctgtatcaggccggttacatcctgacctggtatcacaggtgggtttc
tatgtgaatacattaccactgcgtaccacctttgcggaagatcattcatttgatgccctg
atcgataatgtacagcagacttttctggatgcatttgaacatcaggattatcccctggac
ctgctggtagaggaactggatatcgtacgtgatgaaagtcgtacgccactgttcaacgta
atggtagacttcctggataccaaaacgactgtcaaaaaacccctggaactagatcagctg
atactcagccctttccctgttgacaaggaagccagccagtttgatttatcatttgacttt
acagctgccgagggacagttatccctttacctcaatttcaatacagatattttcagagaa
gatagtatccgcatactcctgagccgttatctgcaacagctgcagaatatggcctttaac
agtgctgcggccatcaataaacaaacttacctgcctgcagaagaacaggcgcgtgtactt
gcatttgcaggtaaaggacaggcaaagctgcctgctaccgacctggtaacacttttcgaa
tcaaaagcacagcaatatggtcatttgccggctgttcattgtgaagactttagtctgagt
tatagcgcattaaatgaactgtccaatcgcctggctgattgcctggtgaaagagtttggc
gtactgcctggtgatcgggtaggtatcatggtcggccgcaatgaatggatggtagtaagc
gtactggccgtcctgaaagcaggtgctgcttatatacccatggatccggaatatgctgct
gaacgcgtgaatcatatgatcgccgacagtggtgtaacagtactgctgactgaactggat
gaattgccggtaacagtggataacatgcgcatactgaacctcgccatatttgaatctatg
gccgatcagtacagcgaactgaacccagttgttaaacctgctacagatgatctggcatac
ctggtatatacatccggttctaccggtttaccaaaaggagcgatgatcacacatcgtcat
ctgttaggtctgtgggatagccttgaaacagcttatgatctcaatacttttgaagtgcgg
ttgctacaggtggccagcatttcctttgacgtattctttggcgatatgcttcgtagcatc
ttcagaggtggcctgatggtgatctgccctgcggaacatcgttataatctgcctgcactg
tatgaactgatgcatagctatcgtattacagtaatggaatctacgcccggtttattactc
ccgctgttggattatatgtatgaagaaggcgcccgtctcgactttatgcgcattttcatc
ctgggttctgataccctgtcagtagaagattaccgtaaaatatatgatcgtttcagccat
agcgagctgcgtatcattaatagctatggtaccactgaaacaactattgattccagcttt
tacgaaggactgggtattgacctgagaagtacaggttatgtacctgtcggtcgtccgctg
gaaaataccaggatgtatgtactggataaagaaatgcaattatgtggtatcggtgtggcg
ggtgaattgtgtatcggcggactgggcgttggtctgggttactggaaccgcccggaactg
accactgaacgctttgtaaccgatccatatgtaagcggcggacggatgtaccgtaccggt
gatctggcccgatggaatgcagctggtaatcttgaattcttaggtcgtggtgataaccag
gtgaagatccgtggttaccgtattgaaccaggtgaagtggaaagcgtactgctggcttat
agtggtgtacaggaggcggtagtactggcctataatgtatctgacagagagaaagaactg
gtaagttatatcgtatggcaggaggcggcagacgaagaagggctgcgcagctggctgaga
gagcagttgccacaatacatgcatcccgcatattatattaccctggaagcgatgccactg
accagcaatggtaaggtagaccgtaaacaactgccggcgccaacattaaacgttaatcgg
gcatatgaaggtccgcgtaataaagttgaggctacactggttggcatctgggaagaagta
ttacagaaacaaccgatcagtatccatgataatttctttgagctcggcggtcattccctg
aaaggaatgcgtgcgttatggcgtattcgcaaagaactgggggtagaactgtccttccgt
gatatgttcagctatccgcgtattacggaattgtcagcattgttaaacagacagactgcc
tctcagggtacagcttatccattggtagcagtagcaaaacaggccagctatgaactgtcc
catgcacaacgccgcctctggttgctggatcagctggaagaacaaggtcgttcttatacc
atgccggtacaataccgcgtgaaaggaacgctacatacagcgcttctggaaaaggcattc
aatgtattgattgcacggcatgagatactgcgtaccatatttattacagaagagggaaat
cctcgtcaacagatattagccgacgcgaagatcgtattggaaactgccgatctgaaagga
cgtgcagataaaggcgaagccctgtccacatatgtaaatcgtatccatcaggcagtattt
aatctgtctgctttcccattattacaagcaggtttatttcaggtagaagaggaggagtat
gtgtttgcatttaatatgcaccacattatctctgatgaatggtccatagaagtaatggta
gaagaactggtaaccatatacgatcagctgaatagcggtgaggccatagatctgcctgcc
cttcctgttcagtataaagattacagtgtatggcagcaggcacaattacagggcagtcag
ctggaaacagcagctgcttactggcggaaccagttcgccgatagcattcctgtactcgat
ctgcctgctgatcatcctcgtccggctgtaaaacgttatgagggccgtacgctgcgtatg
gaactgaataaagaacagctggagggtttatatgaagtaggtcgtcgtaatgaagctagt
ttatatatgaccttactggcgagtgtgaaaggtttattataccgctataccggtcagtct
gatatcgtaataggaagtccggtagcaggtcgtagtcatgaactgctggcacgtcagctg
ggtttttatgtaaacaccctcgcattacgtacacagtttgatgctaacgatagttttgat
ggtctcttgcaatccgtaagagatgtcgtactgggtggttttgagcaccaggactatcct
tttgacctgctggtagaagaactggacgtacaacgcgatataagtcgtagtccgctgttt
gataccatggtcgtattacaggggcgtgactatcagggcatgacgcagcagacatgggag
aatggtctgcaatgggaagaaacatcgacagatgcaggtgtcagcaaatttgacctgacc
cttttgttccgtgagcatgaagaaggcatacaggtggaagtggaatataacacacagttg
ttcagtgctgccaggatggaacgtttttgtgcgcactatgataacttcgttaacggcatt
gtcgccgatagtaccaatgccattgctgaaataacttacctgtcaatagaagagcagcat
cgtttactggatgtattcaatgataccggtaatgatgcttatccttctgaacgtacgatc
catagtctgtttgaagaaaatgcgctgcatatgggcagtcgcacagcggtagtatatgaa
gaccgtacactgacttacgcagcactgaatagtgctgccaacaaagtagctgattacctg
cgccgtgaacatggtgtagaaagtggcgacctggttggtttgatggtagaacgctcagaa
aaactgattatctgtctgctgggtatcctgaaagcaggcgccgcttatgttccggtagat
cctgcttatcctgcagcacgtatcagttatatgctggaagatagcaccccacgggtggta
ttgacggatagtctggcagctgtcgcattgagcaccggtaatgacctgggcaatgtgcct
acagaaggtgatggtacctctttggcttacatgatctatacatctggttctaccggtcag
ccgaaaggagcaatgatcgcacatcatgcagtgatcaaccttagctactggctgcgcgaa
ctgatctatatacagtatccggatggattggtagctatgctgactgcctccattaatttt
gatgcttccgtacagcaattgtttgcgcctttactgtctggttcacagctggtgataatc
agcgaagcagatcgccgtcagatagaacgttatgtagcgcagctgaagaagaaccatgtt
gcggtgatcgatatcacgccaggttacctgcgcgtgttgatggatgtactgaaagtgaca
ggtactgatggactgcaactgaaatacatactggtaggaggagaggcactgcctgcggaa
gaccgtgccctgttccatgaaatatttggtaataccgtacacctgattaatgtttatgga
gtaacagaagcaaccgtagactctacatacgaaatagtgacagctgatgacaataacgga
ttaagtattggtcgtccgctcaagaatacccgcatgtatgtgctggataaaaacctgcag
ctttgtgcttatggtgtaacgggtgaactgtgcattggtggcgctggtgtgggtctgggc
tactggaaccgtcctgaattaacggcagaacgtttcattactgatccttatctggcaggt
ggacgtatctatcgtaccggtgacctggcacgatggacatccgcaggtaatatcgagtac
ctgggtcgtggtgataaccaggtgaagatccgtggttatcgtattgaaccaggtgaagta
gaaaatgtattgggtgcttatagtggcatacgtgaagcggtagtactggcttatagtgta
tctgacagagagaaagaactggtaagttatatcgtatggcaggagggggcagacgaagaa
ggactgcgtaattggttaagagagaaactgcctcaatacatgcatcctgcgtattatatc
accctggatgcgatgccgctcaccagcaatggtaaggtagaccgtaagcagttacctgca
ccggtattgaatgccaattgtacttatgaaggtcctcgtaataaagtagaggaaaccctg
gtgagtatctgggaagaagtattacagaaacatccgatcagcatccatgataatttcttt
gacctcggtggtcattccctgaaaggaatgcgcgccttgtggcgtatccgtcaggaattg
ggtgtagaactgtccttccgtgacatgtttacttacccgcgtattacggagttgtcagca
ctgctgggcagtcaggcaacatccgcagtaacggctaagccactggtagcggtggaagag
cagtccagctatgaactgtctcatgcacaacgccgcctctggttgctggatcagctggaa
gaacagggtcgctcttacaccatgccggtagaataccgggtgaagggagcgctggacgcc
ggtgtattagaggatgcttttaatgcattgattgcgcgtcatgagatactgcgtaccata
tttattacagaagatggtcatccccgtcaacaggtattagcggaagcgaagatcgcatta
gactatgcagatctgaaagcacgtacagataaaggcgaagctttatctgcatatgtaact
cgtattcatcaggcagtcttcaagctgtcaggttttccattattacaggctggtttatat
aaagtagaagaagcagaatatgtgtttgtgctgaacatgcatcatattatctctgatgag
tggtcggcggaagtaatggtagaagaactggtgagcatatatgatcagctaagtaatggt
cagtcaatagaactgccggcgctgcctgttcagtataaagattacagtgcatggcaacag
gcacagttacagggtggtcagctggaaacagcaggagcttactggcggaaccagttcgcc
gatggcatccctgtgctggatttacccgttgataattcccgtcctgctgtgaagacctat
gcaggtcagacattgcggatggaattgaacaaaacgcaactggcaggtttatatgaaaca
ggtcgccgtaatgaggcaagtttatacatgaccctgttggcgagtgtaaaaggattacta
tatcgttacactggtcagtcagatatcgtaattggtagccctgtagcaggtcgtaaccac
gaattactggcacgtcagctgggtttctatgtaaacacactggcattgcgtacacagttc
gacggcagggatagctttgatcgtcttttacaggcagtgagacaggtggtgttaggtggt
tttgaacaccaggactatccttttgaccgcctggtggaagaactggatgtacagcgcgat
atgagccgcagcccgctgtttgatgtgatgcttgtgttacaggaccgtgatgcacgtggt
gtgtctcagcaattccgtagtaatgcactgcaatgggaagaagtgaatatggatacggca
gtcagcaagtttgacctgacattgatttttaaagaacacgcagccggcatctcaatagag
atagaatataatacccggttgttcagtgcagaaagaatagcgcgtttcgcatcacactat
agtgaatttgtcaatgagatagttgctgacagcagcattgccctggcagatatctcttat
ctgtctgcagaagaactcaaccgcgtattacatacattcaatcataccggtagcagtgtt
tatcctgccgatcgtagtatacacagcttgtttgaagaaaaagccctgcgtatgggtgag
agcatcgccgtggtatatgaagaccgtcagctaacctacgcggcattgaacagtgccgca
aataaaatagccgattatctgcgccgtgaacatggtgtagtaaatggcgacctggtaggg
gtaatgatggaacgctcagaacagctgattgtctgtttactgggtatcttaaaggcaggt
gcggcatatgtgccgatagacccttcttaccctgcatcccgtatcagttatatgctggaa
gatagtcttccgagagtagtcctgacagctgctttggccgcggcagcactaagcaatggt
gtagacaatgggaatgttgatactgccaatgatgctaatgcactggcttacattatttat
acttccggttctaccggtaagcctaaaggtgtgatggtaccacacatcggtgtcgttcgc
ctggtgtatgcgccgaactatgttacgttcagcgaagaagacagactcctgcagacgggc
tctgtatcatttgatgccagcacctttgaaatatggggcatgctgctgaacggtggtacc
ctgtacctgctggatcacgataaactgatggacgcagatatactgaaagacaccattcaa
cagcataatatcactatgatgtggttcagtgcgccctggtttaatcagctggtagataac
gacccttccttgtttgaaggattgaaagatatactggtaggaggtgataaattatctcct
gcacatattaacgcggtactttcgttgtacccggatatcaatatcattaatggttacggt
ccgacggagaatacaactttctctatctgttacccgatccgggaagcccagaccggcgca
ataccattaggttatcctgtcagcggtacacaggtatacatcctggataaacaattccgt
ccgttacctgtaggtagctacggcgaactatatctggcaggtgatggtctggctactggt
tacctgaatatggatgaccgcaacagggaacgttttgtcgataatccattcaaaccaggt
acacgcatgtacagtaccggagatatcggcagatggaacaataaaggagaagtagaattt
acaggtcgtaccgatgaccaggtaaaaataagaggcttccgtattgagccaggtgaaata
gcggatgctatcctggaacatacagcagtgaaagatgccgtggtaataccatttacgaca
gctgccggtgaaaaggaactggctgcctatgtggtatggacggcagcaacagcaacagct
gccctgcaatccttcctgcgagacagattaccttcctacatgcaacccggctgttacatc
gatatggaagtactgcctttaaatgcaaacggaaaggtagacagggatggcctgcctgct
cctcagcttgaactgacagcagcactggaagcaccgcgtaatgcaactgaaactgcatta
ttgtccatctggaaaacaatattgcagagagaagatatcggcatctatgacaatttcttt
gataaaggggggcactcgttaagagcatccagactgcttgcgggtatccataaggaactg
aacgtgaaactatcactgaagaccttattcctgcataataccatcgccgcattatctgaa
gtgatcgcagctgcggataaggtaagctatgaagcattgacaccggtagccgaacaggta
cattataatgtgtcacatgcacagaagcgcctgtggatactggatcagatggaaagcaac
accagtgcgtataatatcccgggcgcttacaatatagaaggtcagctggataaaacaata
ctggatgctgcgctgaatatactgctgggaagacacgagagtctgcgtacaatcttcatc
aaatccgctggcgagccaaaacaacaggtacttgctgcggataaggtaaaagcgcagatt
gcttaccatgatctgagagaggacgccaataaggaagccacagcggaacaacttttacat
gcagctatgcataatggctttgccctgcatacctggcctttgttccgtgcttcgctgata
caactggaagcagaacgttacatctttgttttctgtattcaccatattatttcagatggt
tggtcacagggtgtgatcggtaaggagatctctgctatctataatgcattgatagcaggc
cggacccctgaattgtcaaccctgtctgtacaatataaagactataccggctggcatagc
cgtctgttggaaggacagtttggggaagaggcaaaacactattggagcaaacgttttgac
aagcctgctccatggttgaatatgccggcagacagattacgtccacgccttcagacattc
gatggagatgtagttaaatgccgtttcggcacagctgtaacaacacgtttacaacagttc
agcagagaacaggatgcaaccctttttatgagtctgctggccctggtaaacacgttgtta
tatcgctatacaggtatcgatgatatcgtcattacttctccgatagcagcacgagaacat
gccgacctgaatgaccagatcggtttctttgccaatacactgcctttaagaacacgcttt
tctgacgaacagagctttgaagccctgttacaggaagtgaaggatacaaccgtagcggca
taccgctatcagatgtatccttatgatatggtcattgaagacgctacacaacaatacgat
ccgagccatgcagctttatcagatgtaatgctggtattgcagagtaatgaatccacttca
ctggatctgcaaggtacagtgacagctgcgctggatctttccacaaatactgccagattt
gatctcgttttcatcttcacgatggaagagggagagctatgcctggacctcggcttcaat
acgaatatctacgacagagcgcgtatcgttagcatatcacaggccttaacagtactgaca
aataacatgttgtcagcacctgcgattacagtgaaagagctggcggtgaaagatatcccg
gcagatgaagtgtctgataaggacatcccaatggcgatcatgaatggtcacctggtatat
gcggctgaagtgaatgccgctctggagactttgcctggtatcatagcagcgaatgcccag
gtgacggaggagaatacactggatgtattcataacaccgggtggtgaagaaggacatacg
attgcccggttactcaacatcgccctggatgagcatagagaagataaacaggtctacaca
ctccctaacgggttaccgatctgttacaagaacaagacagagacagactttacttatcac
gaggtatttgagcaacatgcttacctgaggaatgatatcaccattcatcccggtgatgtc
atattcgatgtaggcgctaacattggtatgttcagcatgtatgcaggacatcacttccct
ggttgccgtgtattcgccttcgaaccgataccaccgatctacaattgtctggctgctaat
gccgctatgtacaatttaggtattacggcgatgaatatggggctgtccaccgaagagacg
acggcagaattcgtatactatcctaacaacaccatcatctcgggccgttttggcgacgcc
atagaggacaaggaagtggtacgccgctacctgcagaacaaattggatagtgaaggcagc
accatgtcagaaaaacacatggaagagatactggaagatatgatccgttccgagaaatgg
gaatgccggctgtctaccgtatccaatgtgatgagagaacagggtgttgaatggatcgat
ctgctgaaagttgacgtggaaaagagcgaatgggacattttgcagggtattgaagcggct
gactggaaacgtatccggcaggtgattgtggaagtacatgatacggacggtcgtcttgaa
cgtattacccgtctgctggaagaacatggcttcggcgtatatgtagaacaggaagaagaa
ttggctggaacagcgctttataatatctacgcgattcatcatcagcatcagcgagcagcg
gctactcctgctgccgtgaaaccaggatggaacgatgtagctgcttactacacgcatatc
aacggtatgatacatgacagactgcccgcttacctgggtaatgtcaatgtgtacctgact
gattatacaaatgcaattcaaaaaaggaggattgatgcagtaaaaacctacaatgccacc
ttgaagggagtgccggcggcacagcccacgtcccttcagctggtggtggctgctaccttt
acagcagatcctttatcagattatatcacctggtggacagaccgcttcagtattcctgta
caggtaaaactggcaccttacaaccaggtcttccaggaactcctgaatgatgacagcctg
agcgcccgtaacaaggatatcaacctgttgctggtacgctgggaagactggatcagagac
gccaggggaacagctgctgaacaacgccagttggtaacacaaagcctggaacaactgatc
tctgttttacagtcggctcaacggcaggcattgtacatggtcggtgtaataccgcctgta
gcagcggcttgtcctgatactgagatgttccttttcctggaacagattaattatcgctgg
acggcggcgcttgccgggatggaccatgtacatacactggacctgagcagcattggagaa
cgctttggaatagcggagctatatgatacgcaacgtgataaactgggtcatatcccattc
caggaagaagtctatgcagccgtggcaaccatggtggccagacagatcagggcttacaaa
caaccatcgttcaaactgatcgtactggactgtgataatactttatggtctggggtggta
ggagaggatggcgtgaacgggattcagttgttacccgaacatatcgcgctgcaacgtttc
atgaagcagaagaaagaagaaggtttcctgctggcattgtccagcaagaacaatgaggcg
gatgtatgggaggttttcgaacagcgtacggatatggtgctgcggaaggatgatttcgtc
acctggcgtattaactggaataataaggcggctaacatacaggaaatcgtaacagaactg
aatatcggtattaacgcctgctgtttcatagatgatagtccggtagaatgtaccgctgtc
acagctgcccatcctgaagtactcgtattgcagttaccggaagaaaccagttttatacca
cgttggttgtcgcatatctgggccttcgataagttcaccgtaactgaagaagacagaaaa
cgtactgagatgtaccaggcagaaaaagaacgtcggaacatcctggaagcacagcctact
attggtgatttccttgcacagttacaattacagatcatcgtgcaggatgtacaggaagcc
gatattccacgtgtggcacagttgacggaacgtaccaatcagttcaatctgaatggacag
aagaagacggcacacgagatcgaggcatatatgctgggtggcgcccgtcattgtaagaca
atccgggtaacagataaattcggtgattacggtctgacaggcgcattgatcacgactatc
caggaagacagcctgcttgtagacaccttcctgctgagttgtcgtgtgttggggcgtcag
gtagagcaaagtatgctggcagtgctgaaagaacaggcacaggcagccggattgcagaag
attgtttgccatttcacagatacaggcaaaaacaagccttttgcacagttcctggcttcc
acatcctggaccgcggtgcagacagaaggcaaatccactttttacgagatattgccagag
aacatagttgctgtattgcctgtactgacaagtgcggcaccgccggaacctgtagcgaca
acgacagaagaatcaacagtactggtatttgaccatattggtgtagcggtaagcgatctg
gaagcatccctgagattctatacagatagcggattcactgcatcagaactggtatatgat
cctatacagaatgtagaaatttatatgtgccggacagcatctggcggtggtattgaatta
atcgctgcacacgatgaattatctccggtaaacaatattatcagccgtaacggcgatcag
ccttatcactggtgttaccgtgtgaaggacattgatacgctgttcgacaggcttacaaga
aaaggtttggcgtttgaaatagtaaagcaaccggagcaggctgtattgttcggctataaa
cgggtcgtgttcatcgacattaaacaaatcggccttgtcgagtttatagaagacaatgac
agtctgcccggtcagctgctaccggcagagatggaaatcagtatggtcactttcgatatc
cagccggcattacaattcttccagctggtagggtatagggaaacaagacatatcacagat
catgtgaacaaagagtatgtcgttgttctgcatactgccgcaaatggtcctgcaatacgc
ctgatcatgccgctgcctgaagcagttgcagaaagagccgcattcctgcaacagaacggt
ccgcatattcatcgcctgctgttgcatactgatacgacagagaagtatccaatgcatctt
ttgccgccttattttacggtagaagaagaacataaaacagtattgacggatgttgcagat
tgggaaccggtgctggcaatggaaaaagatgccacacactatgctttgcagctgccatta
ctctataacagtggcgccagactcctgcagatacctgtataccaggtacagaaacaaaga
atgaataccggtatgcgtccaccggaaacaacggtagaaaaggcattgttccgtatatgg
gtagaagtactgcgccatgaagcatttggcgtacagacttctttcctggaagctggtggt
aactccatcagggccacacagatactatcccgtatttacaggcagtacggtgtggaatta
ctcctgacagagttcttcaataaaccgacaatcagcgcactcgctgcattgatagaaaag
aaacaaccggaagggttcgaaagtatccgggtattaccagcaatggaacactacccgctt
tccttctctcagaaacaactctggatctcagatcagtttgaaagttcatcaggatctgcg
tttaacatcccggtggcgtacatactcgaaggtcaattggataagacggctttaacaaaa
gctttcagtcgtcttgtagagagacatgagatcttacgtacggtctttgtaaaagccgga
gatgaggcagcacaacaggtattacctgcaacggacgactatagcacacctgaatggata
gacttatcaacgacaccggatgcggaagctgctgccatgaaaatcgctgatgaagaggct
caggttgcctttaacctggaaacaggtcctttactgcggattaaggtgctgcaattgtcg
gcagaacgtaatctcttattatttacaacacatcatattgtttctgatggctggtcgtca
ggtatcatgctgcgggaagtggcggtattctacaacgccatccgcaatggcagaaacctc
gtattacctgccttacctgtacaatacaaagactatgctgcatggcaacaggaacagatg
caacgtccggcattcgctgcacatcgccagtactggctgagccagttccaggacggcgtg
cctgctttacagttgccatacgatttcccgcgtccctcattcaaaagctacaatgggaac
acccgcagctttatactggataaaacgcagacagcaaagatcaagacctttatggaacag
caggagatcagtctctttatgttctttgtaagtgtcactaaactgttgctctaccgtctc
tcaggacagcaggaactcgtggttggtttccctgtttcaggccgctatcacccggaactg
gaagatcaggtaggctgttatgtcaataccatcgcgcttcgctctaaactggatacacag
tccagtttacaggatttcgttcatgagatcaggcagagtatcacccatgcttatacacat
gccgcttatccttttgagcgcctggtggaagaactgggaggacacacagacctgagcaga
tcgccgctgtttgatgtgatggtccagatacaggatgcacacatggtacaccagcaggat
gctgcagcattggaaggtcttagtatccatatggcggatcagcaactggccttcagcaag
tacgatctgacagtcaatgtcatggaaacagacgacggcatttccatcgacctggaatat
aatacagacctcttcaaacccgacacaattaacaccattcaggctgattgcatacgcctg
atacacatactccttaccgaaagcgtacgcacactgggcgaaacgcgtatgctgctggcc
gcaggcagtggtaaccttatgcagcaatatcaacaggcatttactgccagcatagacgaa
tctttctaa

DBGET integrated database retrieval system