KEGG   Chitinophaga pinensis: Cpin_6171Help
Entry
Cpin_6171         CDS       T00959                                 

Definition
(GenBank) glycoside hydrolase family 2 sugar binding
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00052  Galactose metabolism
cpi00511  Other glycan degradation
cpi00600  Sphingolipid metabolism
cpi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Cpin_6171
  Lipid metabolism
   00600 Sphingolipid metabolism
    Cpin_6171
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Cpin_6171
Enzymes [BR:cpi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Cpin_6171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4982 Glyco_hydro_2_C Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5 Cellulase
Motif
Other DBs
NCBI-ProteinID: ACU63579
JGI: Cpin_6171
UniProt: C7PH28
LinkDB All DBs
Position
7787822..7790263
Genome map
AA seq 813 aa AA seqDB search
MNKCKIALLAMVLMSVKGMSQARQEYLLEKNWKFAKGEHPQALNEAFNDKSWETVRIPHD
WAIKGPFDGNNDLQKVQIVQNGEQEATMKAGRTGGLPFIGAGWYRLSFSVPEFRAGKKAV
LLFDGAMSNAVVYVNGKKVGNWPYGYNSFSFDITSFLHTKAQNTLAVRLENFEQASRWYP
GAGLYRNVHLIVTNDTHVPVWGTYLTTPTITQENAAVQLLTTIDRSNKQSTLSVKTRLLD
AAGKVVATAVTPLKADSSTVTQQFSIAHPVLWSPETPVMYKAVTQVYEGTQLKDQYETPF
GIRTIEYKAGKGFLLNGQPRKFRGVCNHHDLGPLGAAINTAALRRQIRLLKDMGCDAIRT
SHNMPAPELVTLCDEMGIMLMVESFDEWKAPKVKNGYSFYFDDWVEKDLLNMLHHYRNNP
SNIMWSIGNEVPDQSSANGKDIARRLQDICHREDPTRPVTAGMDRFDDAINKGFAAVLDI
PGFNYKPARYPEAHSKLPQGFLMGSETASTVSSRGIYKFPVGFYKGKMYDDNQCSSYDFE
VCSWSQVPDDEFVQQEDLGYTMGEFVWTGFDYLGEPTPYDSKWPSHSSYFGIFDLAGIPK
DRFYLYRSHWNKQQPTLHLLPHWTWPGREGQVTPVFCYTSYPSAELFVNGKSMGKLSKDT
STHQSRYRLMWNDVVYQPGTIRVVAYDNTGKAVAEDSVSTAGTPHHIQLEADNNVLTADG
KDLSYITASVVDAKGNLCPAATNLLQFEITGAGSFKAVANGDPTCLEAFHLPQMKAFSGK
LVFIVQSGEKTGVVKALVKSDGLQSASCTIHVK
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagtgtaaaatagcattactggcaatggtactcatgagtgtaaaagggatgtcc
caggcacgtcaggaatacctattggagaagaactggaagtttgccaaaggcgagcatccg
caggccttaaatgaggcgtttaatgataaaagctgggagacagtccgcataccgcacgat
tgggctataaaaggcccgtttgacggcaataacgatttacaaaaagtacagatcgtacag
aacggtgaacaggaagcaacaatgaaggcaggccgtacaggtggtctgccgttcattggc
gcgggctggtaccgtttgtccttctccgtcccggaattccgcgcaggcaaaaaggcggtc
cttctttttgacggcgccatgagcaacgcagtagtatatgttaatggtaaaaaagtgggt
aactggccctatggctataactccttctcttttgacattacctccttcctgcatacaaaa
gcgcagaacacactcgccgtacggctggaaaacttcgaacaggcttcccgctggtatccc
ggcgcaggactgtaccgcaacgtacacctgatcgtcaccaacgatacgcacgtgcctgtc
tggggtacttatctcaccaccccgacaatcacacaggaaaatgcagcagtacaactcctg
accaccatcgacagaagtaataaacaatctacactcagcgtaaagacccgtctgctcgat
gctgccggtaaagtggtagctactgccgttacgcctttaaaagcagacagcagcaccgtc
acacagcaattctccatagcgcatcccgtactatggtctccggagacccccgtcatgtac
aaagccgtcacacaggtatatgaaggaacacagctaaaagaccaatatgagacgcccttc
ggtatccgtaccatcgaatacaaggccggtaaaggtttcttgctgaatggtcagccgaga
aagttcaggggcgtttgcaatcaccatgacctcggtccgctaggcgctgctatcaacacc
gccgctttacgcagacagatccgcctgctcaaagatatgggctgcgacgcgatccgtaca
tcgcacaacatgcccgcaccagaactcgtaacactttgtgatgaaatgggcatcatgctg
atggtagagtcttttgacgaatggaaagcaccaaaagtgaagaatggttacagcttttat
ttcgatgattgggtcgaaaaggatttactgaatatgctgcatcactaccggaataatcct
tccaatatcatgtggagcatcggcaatgaagtacctgatcaaagctccgccaatgggaaa
gacatcgcacgccgcctgcaggacatctgtcaccgcgaagaccctacccgtccggtaacg
gcaggtatggaccgttttgacgatgctatcaataaaggcttcgccgctgtactcgatata
ccgggctttaattacaaacctgcccgttatccggaagcccacagtaaactcccacagggt
tttctcatgggttcagaaacggcgtctaccgtaagttccagggggatttataaattcccg
gtgggtttctacaaaggaaaaatgtacgatgacaaccaatgttcatcctatgacttcgaa
gtctgctcctggtcacaggtgcctgatgacgaattcgtacaacaggaagacctcggctac
accatgggtgaattcgtatggaccggtttcgactatctcggcgaacctaccccctatgat
tccaaatggccttcgcacagctcctatttcggcatcttcgacctggcaggtattccaaaa
gaccgtttctacctgtatagaagtcactggaacaaacaacaacccactttacacctcctg
cctcactggacatggccaggcagagaaggacaggtcacacctgtattctgctataccagt
tatccttcagcagaactctttgtcaatgggaaaagcatgggaaaattaagcaaagacact
tccacgcaccaaagccgctaccgcctgatgtggaatgacgtggtctatcagccaggtacc
atccgtgtagtggcttatgataataccggtaaagccgttgcagaagacagcgtatcgaca
gccggcacaccacatcatatccagctggaagcggacaataacgtgttaaccgccgatggg
aaagacctgtcttatattacagctagtgtagtagatgcaaaagggaatctttgtcctgcc
gccacaaacttattgcagtttgaaataacaggtgcaggtagctttaaagcagttgccaat
ggcgatcctacctgcctggaagcctttcatttaccgcagatgaaagcatttagtggtaaa
ctcgtatttattgttcaatcgggagaaaaaacaggcgttgtaaaagcgcttgtaaaatca
gatggcttgcaatctgccagttgtacaatacatgttaaataa

DBGET integrated database retrieval system