KEGG   Chrysemys picta (western painted turtle): 101945875Help
Entry
101945875         CDS       T04662                                 

Gene name
SUV39H2
Definition
(RefSeq) suppressor of variegation 3-9 homolog 2
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cpic00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101945875 (SUV39H2)
Enzymes [BR:cpic01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101945875 (SUV39H2)
Chromosome [BR:cpic03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101945875 (SUV39H2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101945875 (SUV39H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 363 aa AA seqDB search
MQPPARWRAGEEGTEYFLVKWKGWPESSNTWVALKNLKCPLLLQYFHSDKNEYLSQLKRG
KAVILKNHIKALNPVVAQYVVKKAKQRIALQRWKEELNRKKNHKGMILVENTVDLEGPPL
DFYYINEYKPAPGINVMNGITTGCECSDCPAEKCCPEEAGFFLAYNKQKQLKIQPGLPIY
ECNSYCRCGPECPNRIVQKGTPYSLCIFRTNNGRGWGVKTLQKIKTKRFVMEYVGEVITS
EEAERRGQLYDNQGNTYLFDLDYDSDEYTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNL
DLRLPRIALFSTRTIKAGEELTFDYQMKGSLDVTSDSDAVSPTRKRIRTVCKCGAMCCRG
YLN
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcagccccctgcaagatggcgggcaggcgaggagggcacagagtacttccttgtgaaa
tggaaaggatggccagaatcctcaaatacctgggtagctttgaaaaatcttaaatgccca
ttgctccttcagtacttccatagcgacaagaatgaatatttatctcagctaaagcgaggc
aaagcagtaatattgaaaaaccacattaaagctttgaaccctgtagtagcacagtatgta
gtaaagaaggctaaacaaagaatagctctacagagatggaaggaagaactcaaccggaaa
aagaaccataaaggaatgattcttgtagaaaacactgtggatcttgagggccctccttta
gacttttactacattaatgaatataaacctgctccaggaataaatgtaatgaatggaatc
acaaccggctgtgaatgctctgattgccctgctgagaagtgttgtccagaagaggctgga
tttttcttggcttacaataaacaaaagcagttaaaaatccaaccaggcttgcctatctat
gaatgcaactcgtactgtagatgtggtcctgaatgccctaacaggatagtacagaaaggc
acaccatattctctttgcatcttcagaactaacaatggacgtggctggggagtaaaaacc
ctccagaaaattaaaaccaagagatttgtgatggagtatgttggagaggtgatcacaagt
gaggaagcagagagacgaggtcaactgtatgacaaccaaggaaatacatacttgtttgac
ttggactatgactcggatgaatatacggtggatgcagctcgatatggaaatgtgtcccat
tttgtgaatcacagctgtgatccaaatcttcaggtcttcaatgttttcattgataacctt
gatctacgtcttcctcggatagcactgttttctacgagaaccatcaaggctggagaagag
ctcacctttgattatcagatgaaaggttctcttgatgtgacttcagactctgatgctgtc
agcccaacgagaaagaggatcagaactgtgtgcaagtgtggagctatgtgttgcagaggg
tatctcaactga

DBGET integrated database retrieval system