KEGG   Chrysemys picta (western painted turtle): 101950006Help
Entry
101950006         CDS       T04662                                 

Gene name
TGM1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
Enzymes [BR:cpic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101950006 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_core ASH
Motif
Other DBs
NCBI-GeneID: 101950006
NCBI-ProteinID: XP_008172717
LinkDB All DBs
Position
Un
AA seq 607 aa AA seqDB search
MPFDPHNEIYILFNPWCREDAVYLPQDDWLEEYVLNESGRIYYGTESQIGERTWNYGQFD
RGLLDACLYILDRRGMPHSGRGDPISVSRVVSAMVNSLDDNGVLVGNWTGDYSRGTNPSA
WVGSVDILRQYHRTGYPVLYGQCWVFAGVVTTVLRCFGIATRTVTNYNSAHDTDVSLTMD
IYFDENMKPLERLNADSVWNFHVWNDCWMTRPDLPSGYDGWQVVDATPQETSSGIFCCGP
CSVQAIKNGLVYLKYDAPFIFAEVNSDKVYWQRQADGTYKIVYVEEKAIGHLISTKAVGS
HERHDVTDIYKHPEGSEAERKAVETAARHGTKAHIYKNKEWGEDVSLSVETSEAVMGQDV
SVQVALNNRGSSSRSVALTLHLAPMFYTGVTGSTFKQESRQVEIPAGGAQSVRMVVSYAE
YQPHLVDQAALMLSVSGKVAQTGQVLAKQHSFRLRTPDLTLTVLGPAVVGKETQVQVVFK
NPLPQTLKSAVFHMEGSGVSSPKATNIGTIGGHQTISFRQTFVPLRAGRRQLVASLDSPQ
LSQVHGVVTVDVAPAAGSQPAPARSSPARNSPARGSPARGSPARGSPSRQPDPRNSPARN
REPGRAG
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgcccttcgacccccacaacgagatctacatcctcttcaacccctggtgccgcgaggac
gccgtgtacttgccccaggacgactggctggaggaatatgtgctcaacgagagtgggcgc
atctactacggcaccgagagccagatcggggagcgcacctggaactacgggcagtttgac
cgggggctgctggacgcctgcctgtacatcctggaccggcgcgggatgccccactcgggg
cgcggggaccccatcagtgtctcccgcgttgtctccgccatggtgaactccctggacgac
aacggggtgctggtggggaactggacgggcgactactcgcggggcaccaacccctcggcc
tgggtgggcagcgtggacatcctccggcagtaccaccgcaccggctaccccgtcctctac
ggccagtgctgggtctttgccggcgtcgttaccaccgtcctgcggtgcttcgggattgcc
acacgcacagtcaccaactacaactcggcccacgacacggacgtcagcctcaccatggac
atctacttcgacgagaacatgaaaccgctggaacggctcaacgccgactccgtctggaat
ttccacgtgtggaacgactgctggatgacccggcccgacctgccctcggggtacgacggg
tggcaagtggttgatgccactccccaagagaccagcagtggtatcttctgctgcggaccc
tgctcggtgcaggccattaagaacgggctggtgtacctgaagtatgacgcgcccttcatc
tttgctgaggtgaacagcgacaaggtgtactggcagcgccaggccgacggcacctacaag
atcgtctacgtggaggaaaaggccattgggcacctgatcagcaccaaggccgtgggctcg
catgagcgtcacgacgtcaccgatatctacaaacaccccgagggctcggaagcggagcgg
aaggcggtggagacagcggcacggcatggcaccaaggcacacatctacaagaacaaggag
tggggtgaggacgtgtcgctgagtgtggagacctcggaggccgtcatgggccaggacgtg
agcgtccaggtggccctgaacaaccggggcagcagcagccgcagcgtggccctcactctg
cacctggcacccatgttctacacgggcgtgacggggagcaccttcaaacaggagagccgg
caggtggagatcccggcgggaggagcccagtccgtccgcatggtggtgtcctacgccgag
taccagccccacctcgttgaccaggctgccctcatgctcagcgtctcggggaaggtggct
cagaccgggcaggtactcgccaagcagcacagcttccgccttcgcacgccggacctgacg
ctcacggtgctgggcccagctgtggtggggaaggagacgcaagtgcaagtcgtcttcaag
aacccgctgccccagacactgaagagtgctgtcttccacatggaggggtcgggggtgtcc
agccccaaggccaccaacatagggaccatcggcgggcaccagacgatctccttccgccag
accttcgtgccgctccgggccgggcggcgccagctggtggccagcctggacagcccgcag
ctctcccaagtccacggggtggtgaccgtggatgtggccccggctgcagggagccagccg
gcccctgctcgcagctccccagcccgcaactccccagcacggggctccccggccaggggc
tccccagcgcggggctccccctcgcgccagccagacccccggaattcccccgcccggaac
cgagagccaggccgcgccggctga

DBGET integrated database retrieval system