KEGG   Chrysemys picta (western painted turtle): 101951129Help
Entry
101951129         CDS       T04662                                 

Gene name
PCSK2
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 2
  KO
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
Enzymes [BR:cpic01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     101951129 (PCSK2)
Peptidases [BR:cpic01002]
 Serine Peptidases
  Family S8: subtilisin family
   101951129 (PCSK2)
Chaperones and folding catalysts [BR:cpic03110]
 Intramolecular chaperones
  Subtilisin family
   101951129 (PCSK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 462 aa AA seqDB search
ICVFQNAKASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVA
GIRMLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKG
RGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFS
NGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLDLTWRDMQHLTVLT
SKRNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSIQEP
EKIPSSGKLVLTLTTDACEGKENFVRYLEHVQAVITVNSTRRGDLNINMTSPMGTKSILL
SRRPRDDDSKVGFDKWPFMTTHTWGEDPRGTWVLEVGFVDSMPQKGVLKEWTLMLHGTQS
APYIDQIVRDYQSKLAMSKKEELEEELDEAVERSLKSILSKN
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atttgtgttttccagaatgccaaagccagctatgacttcagcagtaacgatccctaccca
tatccccgctacacagatgactggtttaacagtcatggaaccaggtgtgcaggggaagtg
tcggctgcagcaaacaacaacatctgtggagttggcgtggcatacaactcaaaggtggca
ggtatccgaatgctggaccagccttttatgacagacattattgaggcttcttcgatcagt
cacatgcctcaagtcatagatatatatagtgccagctgggggccaactgataacggaaag
actgtggatggacctagagaactaactttgcaagccatggcagatggtgtgaacaagggc
cgtggcggcaagggaagcatctacgtctgggcctctggagatggaggcagctatgatgat
tgtaactgtgacggctatgcatcaagcatgtggactatctccatcaattctgctattaat
gatggccggacagctctgtacgatgaaagctgctcttcgaccctggcctccacgttcagc
aatgggaggaagagaaatcccgaagctggtgtggctactacggatttatatggcaactgt
accctacgtcattctggaacatctgcagctgcacctgaggcagctggcgtgtttgcgttg
gcactggaggctaatctggatctgacgtggagagacatgcagcatctgacagtgctcacc
tccaaaaggaaccaacttcatgacgaagtccatcaatggcgtagaaatggtgttggtctg
gaatttaaccatctgtttggctatggagtcctcgatgctggggcaatggttaaaatggca
aaagactggaagactgttccagagagattccactgcgttggaggatcaatacaagaacct
gaaaaaataccatcaagtggcaagttggttctaacacttacaactgatgcttgtgagggg
aaagaaaactttgtccgctacctagaacatgtgcaagcagttataaccgtgaactctact
aggcgaggggacctcaacatcaatatgacatcacctatggggactaaatccattttactg
agccgacgtccaagagatgatgactccaaggtgggttttgacaaatggcctttcatgaca
acacatacttggggagaagaccccagaggcacttgggttctggaagttggatttgttgat
agcatgccacagaagggagtactgaaggaatggacattgatgctacatggtacacaaagc
gcaccatatatagaccaaatagtaagagattaccaatccaaactggctatgtccaagaag
gaagagctggaagaagaattagacgaagcggtagagagaagtctgaagagtatactgagc
aagaactag

DBGET integrated database retrieval system