KEGG   Chrysemys picta (western painted turtle): 101951503Help
Entry
101951503         CDS       T04662                                 

Gene name
SUV39H1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cpic00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101951503 (SUV39H1)
Enzymes [BR:cpic01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101951503 (SUV39H1)
Chromosome and associated proteins [BR:cpic03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101951503 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101951503 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 101951503
NCBI-ProteinID: XP_005313878
LinkDB All DBs
Position
Un
AA seq 425 aa AA seqDB search
MSCYNGVGVTRNIELARCAVCCKSSWSQLQDLCRLERVRCPSLGITRRNLSHFEVEFLCD
YKRVREEEFYLVKWRGYPESENTWEPRKNLRCVGLLKQFHKDLEQAWIRRDGKPKKNARW
LDQGVANYVVQKAKQRRALWRWERQLNAKRNHKGRIMVENEVDLDGPPRDFVYINEYKVG
EGISLTQVAVGCECRDCLAEAAGGCCCPGASRHKFAYNELGQVRIRAGLPIYECNARCRC
GAECSNRVVQRGIRYDLCIFRTANGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQ
IYDRQGATYLFDLDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIA
LFATRHIRAGEELTFDYNMQVDPVDAESTRMDSNLGRAGGLAGSPKKRVRIECKCGAESC
RKYLF
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgttataatggcgtcggcgtcacccgcaatatagaacttgctcgctgtgccgtg
tgctgcaagtcctcatggtcccagctgcaggacctgtgccggctggagagggttcgctgc
ccctcgctaggcatcacccgcaggaacctcagccacttcgaggtggagttcctgtgcgac
tacaagagagtgcgggaggaggagttctacctggtgaagtggcgcggctacccggagtcg
gagaacacctgggagccgcggaagaacctgcgctgcgtgggcctgctgaagcagttccac
aaggacctggagcaggcctggatccggcgggacggcaagcccaagaaaaacgcccgctgg
ctggaccagggcgtggcgaactacgtggtacagaaagccaagcagcggcgggccctgtgg
cgctgggagcgccagctgaacgccaagcgcaaccacaaggggcgcatcatggtggagaac
gaggtggatctcgatgggccgccccgggacttcgtctacatcaacgagtacaaggtgggc
gagggcatctccctcacccaggtggcggtgggctgcgagtgccgtgactgcctggcggag
gcggctggcggttgctgctgccccggtgcctcccgtcacaagttcgcctacaacgagctg
ggccaggtgcgcatccgggcagggctgcccatctacgagtgcaacgcccgctgccgctgc
ggggccgagtgctccaaccgcgtggtgcagcggggcatccgctacgatctgtgcatcttc
cggaccgccaacgggcgcggctggggcgtgcgcaccctggagaagatccgcaagaacagc
ttcgtcatggagtatgtgggagagatcatcacatcagaagaggcggagcgacgagggcag
atctacgaccgccagggtgctacctacctctttgatctggactacgtggaggatgtttac
acagtggacgctgcctactacggcaacatctcacacttcgtaaatcacagctgcgacccc
aacctgcaggtgtacaacgtgttcatagacaacctggatgaacggctgccgcgcatcgcc
ctcttcgccacgcggcacatccgggccggggaggagctcaccttcgactacaacatgcag
gtggacccggtggacgcagagagcacacggatggactccaacctgggccgggccggcggc
ctggccggctcccccaagaagcgggtgcggatcgagtgtaagtgtggggccgagtcctgc
cggaagtacctcttctag

DBGET integrated database retrieval system