KEGG   Corynebacterium pseudotuberculosis 3/99-5: Cp3995_0391Help
Entry
Cp3995_0391       CDS       T01689                                 

Gene name
nanH
Definition
(GenBank) Neuraminidase (sialidase)
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
cpl  Corynebacterium pseudotuberculosis 3/99-5
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cpl00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Cp3995_0391 (nanH)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Cp3995_0391 (nanH)
Enzymes [BR:cpl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Cp3995_0391 (nanH)
Bacterial toxins [BR:cpl02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Cp3995_0391 (nanH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
401121..403205
Genome map
AA seq 694 aa AA seqDB search
MTDSHRRGTRKALVTLTAALALTTQGLTAPATLAEEGSTIVPAPIDNNGLFDAAPPAPVA
RGAVGEGKLPDPVTSEFFDSKVIRDVDPAGQRCFRIPAIATAVDGTLLVAFDNRYGPDAQ
SRTWCRDAPYENTKRNSREKQTDIEIYRSHDSGKSFEEGDFIAKGTEDPRDLSYTDPSIV
VDHETGKIFAVFVRGYDYRFFDATAGVNRGSVEDPIQKRSVQDTVIIESNDNGQTWGNMK
LLSELTEKIKVRHKPGQELAGRGRFATSGNGIQLKYGENAGRLLFPMSVHYSPNGAGAVA
NVALYSDDHGATWNVGQGVGGEGETNGDENKLVELSDGRIMMNSKSTGSNPSNPRGAERW
RSYSEDQGETWSKPEPVIVAPPQHPLQRNTGINVSLIKAYPSAPEGSAAARVLLYSAPID
TRIKGEYGQDGRSNGWVMASCDDGRSWTHGRQIEAGRFQYSVMTPMADGNIGMVYESGDK
ERGMTLKFAKFNMAWLGADCLSNKALGITDLPDPALAKAIEDAKAATAKAEEATANVLKL
TKELEEAELENEELAQALAEAKSAAQDAIAAAEEANARVKAAEGATIEAEEAAMKAENEA
KALAEQLAKVEAELANSQDQAKALAEAKEAAEIARKAAEEALKLEKEKSGKAGGTDNTEN
KGFWQELLRIFPGFAPIFSFLASIWGGMQKLLAF
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgacggattcacaccgccgtggaactcgcaaagcgctggtaacactcacagcagcgctg
gcgctcaccactcaaggccttacggctcctgcgactcttgctgaagagggttcgaccatc
gtacctgcgcccattgataataatgggcttttcgacgctgccccgcccgcgcccgtagcg
cgtggtgcagtgggggagggtaagcttcccgaccctgtaaccagcgaattttttgattcg
aaggttatcagagacgtagacccggcagggcagcggtgcttccgtattccggctatcgct
acggcagtagacggaactcttttggtggcttttgataaccgctatggaccagatgcgcag
agcaggacctggtgtagggatgcgccttacgagaacacgaaacgtaattcgcgtgaaaag
cagacggatattgagatttatcgctctcatgattccggtaaatcctttgaggagggcgac
ttcattgccaaggggaccgaggatccgcgggatctttcctataccgatccctcaatcgtt
gtagaccatgaaacagggaagatatttgcagtctttgtgcggggttatgactaccgcttc
tttgatgcgactgcaggtgtaaatagaggttccgttgaagatccaatacagaaaaggtcg
gttcaggataccgtcataattgaatcgaacgacaacggtcaaacctggggaaacatgaag
cttctcagcgagttgacggagaaaattaaagtccggcacaagcctgggcaagagcttgcg
ggtcgtggaagatttgcgacttctggtaacggaatccaattaaagtacggggaaaatgcg
ggacggttacttttcccaatgtcggtgcactacagcccaaatggtgctggggctgtagca
aacgtagcgctttattccgatgaccatggggcgacctggaatgttggacaaggcgtcggg
ggcgagggagagacgaacggggatgagaataagctagtggagctttccgatggtcgaatc
atgatgaattcgaagagtacgggaagtaatcctagtaatccgagaggcgcagagcgttgg
aggtcttattcagaggatcagggagaaacctggagtaagcctgaaccggtaatcgttgcg
ccacctcagcacccattgcaaagaaatactggtatcaatgtttctctgattaaggcatac
cctagtgccccggaaggcagtgctgccgcgcgggtgctcttgtactctgctccgattgat
acccgaattaaaggagaatacgggcaagacgggcgtagcaatggttgggtcatggcctcc
tgtgatgacggtaggtcgtggacgcacgggcgtcagatcgaagctggccgttttcagtac
tcggtcatgactcctatggctgacggcaatattggcatggtgtatgaatctggcgataag
gaaaggggaatgaccctcaagtttgccaagttcaacatggcttggctgggagccgattgc
ttgagcaacaaagccttgggtattaccgatttgccggatcctgctttggctaaggctatt
gaagacgcgaaggctgcgacggctaaggctgaggaagctacggcgaacgtgctaaagcta
actaaggaactagaagaagccgagcttgaaaacgaagagcttgcacaggctctggctgag
gctaagagcgcagcacaggatgctatcgctgccgctgaggaggctaatgctcgggttaaa
gcagctgagggagctacgattgaggctgaagaagctgcaatgaaagcagagaatgaggct
aaagcgttagcggaacaattggctaaggttgaggcggagctagcaaattcccaagatcaa
gccaaggccttggctgaggctaaagaggctgctgagattgctcggaaggcagcggaagag
gcccttaagctggaaaaggagaagtctggaaaagccggcggtacagataacactgaaaat
aaaggtttttggcaagaacttttacggatttttccgggatttgcacctattttcagtttc
ctagcgtcgatatggggcggcatgcagaagctgctggcattttaa

DBGET integrated database retrieval system