KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0341Help
Entry
CpC231_0341       CDS       T01877                                 

Gene name
tuf
Definition
(GenBank) Elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
cpq  Corynebacterium pseudotuberculosis C231
Brite
Translation factors [BR:cpq03012]
 Eukaryotic Type
  Elongation factors
   CpC231_0341 (tuf)
 Prokaryotic Type
   CpC231_0341 (tuf)
Mitochondrial biogenesis [BR:cpq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CpC231_0341 (tuf)
Exosome [BR:cpq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CpC231_0341 (tuf)
  Exosomal proteins of breast cancer cells
   CpC231_0341 (tuf)
  Exosomal proteins of colorectal cancer cells
   CpC231_0341 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ADL09833
UniProt: D9QEB0
LinkDB All DBs
Position
359980..361170
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAYPDLNEAFAFDAIDKAPEEKE
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEIRELLAEQDYDEEAPIIHISALKAL
EGDEEWTKSILELMQACDDSIPDPERETDKPFLMPIEDIFTITGRGTVVTGRVERGQLNV
NEDVEIIGIKEKSTQTTVTGIEMFRKLLDYTEAGDNCGLLLRGIKREDVERGQVVVKPGA
YTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNVD
MSVTLIQPVAMDEGLRFAIREGSRTVGAGRVTKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggctaagttcgagcgtactaagccgcacgttaacatcggtaccatcggtcac
gtcgaccacggcaagaccaccactaccgctgctatcaccaaggttctggctgacgcatac
ccggatctcaacgaggctttcgccttcgacgccattgacaaggcaccggaggagaaagag
cgtggcatcacgatcaacatctcccacgttgagtaccagaccgagaagcgccactacgca
cacgtggatgctccgggtcacgccgactacatcaagaacatgatcaccggcgctgctcag
atggacggcgcaatcctcgtggttgctgctaccgacggcccaatgcctcagacccgtgag
cacgttctgctcgctcgccaggttggcgttccttacatccttgttgctcttaacaagtgc
gacatggttgacgatgaggaaatcatcgagctcgtcgagatggagatccgtgagctgctc
gctgagcaggattacgatgaagaggctcctatcatccacatctccgctctgaaggctctt
gagggcgacgaggagtggaccaagtccatcctcgagctcatgcaggcttgcgatgattcc
atcccggatccagagcgcgagaccgacaagccattcctcatgcctatcgaggacatcttc
accatcaccggtcgtggcaccgttgttaccggccgtgttgagcgtggccagctgaacgtc
aacgaggacgttgagatcatcggtatcaaggaaaagtccacccagaccaccgttaccggt
atcgagatgttccgtaagcttctcgactacaccgaggctggcgacaactgtggtctcctc
ctccgtggtatcaagcgcgaagacgttgagcgcggtcaggttgttgttaagccaggcgct
tacactcctcacaccgagttcgagggctctgtctacgtcctttccaaggacgagggcggc
cgccacaccccgttcttcgacaactaccgtcctcagttctacttccgcaccaccgacgtt
accggtgttgtgaagcttcctgagggcaccgagatggttatgcctggcgacaacgtcgac
atgtccgtcaccctgatccagcctgtcgctatggacgagggcctgcgcttcgctatccgc
gagggctcccgcaccgttggcgctggccgcgtcaccaagatcatcaagtaa

DBGET integrated database retrieval system