KEGG   Collimonas pratensis: CPter91_2612Help
Entry
CPter91_2612      CDS       T04306                                 

Definition
(GenBank) AMP-binding enzyme family protein
Organism
cpra  Collimonas pratensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2655109..2656893)
Genome map
AA seq 594 aa AA seqDB search
MKLESMVDAILSAVEHPQQGAERQITVIEESGEEKSISYATLAQQALATSSALVGLGVRS
NDLVILALPASIDHLLLLTACVLAGALPCTVPLPGRLMADSPRNQIYIACQLFSPRLLIA
ADSNAASLQNLLAATGTRVASIADLNAAATAGYPLRVERRGADGGHHVQLTSGSTGRPKA
VILSHRNVIDNVLGIGGSVGYDAERGDASASWLPLYHDMGLVTLLSNLYYQSPLLLMQPS
SFIRNPLGWLKRMSQFGTTTTAAPTFGLQYCIRRYREASMKDVDLSKLRNIFIGAERVDE
TCLRDFAQKFAPHGLSRSALQPCYGMAESTLAVTMHDATAAYDAAALTYVMPDRIDSGAL
IEHSLARPVDGATRLAETVLSMGKPIPGMQVAIRSGPDSNARKREVGEIYIRGSSIMSGY
LPSEGQVEHYQSGDWFATGDLGYTVDEHLYVLGRKKEIIIIRGSNYFPHEVEDVIAAHPL
LENGGNAIAAIGVYDETQGTENLVVMIEHEKTEAQAALRAELQASLRDKFGFGAHAIEFV
ASGSLPRTTSGKLQRLKCRDIYIKKTLQDDSKDGGQDTDDAGADSEAKPTTVAI
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgaaactggaatcaatggtcgacgccattctgtctgctgtagagcatccacagcaaggc
gcagagcggcagatcaccgtcatcgaagagagcggcgaagagaaaagcatttcctatgca
acgctggcgcaacaagcgctggcgacctcttccgcgctggtcgggcttggcgtgcgcagc
aacgacctggtgattctcgccctgccggcatcgattgaccacctgttacttctgacagct
tgcgtgctggccggtgccctgccatgcacggtgccgctgcccggccgtctgatggcggac
tcgccgcgcaaccagatctacatcgcttgccagctgttttcgccgcgcttgctgattgcc
gccgacagcaacgccgcgtcattgcagaacctgctcgccgccaccggcacccgcgtggct
tccatcgccgacctgaatgccgctgcaactgccggctatccgctgcgggtggaacgccgt
ggcgccgacggcggccaccatgtgcaactgacttccggctccaccggccggccaaaagcc
gtgatcctgagccatcgcaacgtgatcgacaatgtgctcggcatcggcggctcggtcggt
tacgacgccgagcgtggcgatgcttccgcttcctggctgccgctctatcacgacatgggg
ctggtgacgctgctgtcgaatctgtattaccagtcgccgctgttgctgatgcagcccagc
agcttcatccgcaatccgctcggctggctcaagcgcatgtcgcagttcggcactaccact
accgcggcgccgaccttcggcctgcagtactgcatccgccgctaccgcgaagcatcgatg
aaagatgtcgatctcagcaagctgcgcaatatcttcatcggcgccgaacgggtggatgag
acatgcctgcgcgactttgcgcagaagtttgcgccgcatggcctgtcccgttcggcgctg
cagccatgctatggcatggccgagtcgacgctggcggtcaccatgcatgacgccaccgca
gcttacgacgccgctgcgctgacctacgtaatgcctgaccgcatcgactccggcgcgctg
atcgaacattcgctggcgcgtccggttgacggcgccacgcgcctggcggaaaccgtgctg
tccatgggcaagccgattcccggcatgcaggtcgccatccgcagcggccccgacagcaac
gcccggaaacgcgaagtcggcgaaatctatatccgcggctcttccatcatgtccggctac
ctgccgagcgagggccaggtcgagcattatcaaagcggcgactggttcgccaccggcgat
ctcggctacacggtggatgaacacctgtatgtgctgggccgcaagaaggaaatcatcatc
atccgcggcagcaattattttccgcacgaagtcgaggacgtgatcgccgcccatccgcta
ctggagaacggcggcaacgccatcgccgccatcggcgtctacgatgaaacccagggcacc
gaaaacctggtggtgatgatcgaacatgaaaagacggaagcgcaagccgcgctgcgcgca
gagctgcaagcctccctgcgcgacaagttcggcttcggcgcccacgccatcgaattcgtc
gcctccggcagcctgccgcgcaccaccagcggtaagctgcagcgcctgaaatgccgcgac
atctatataaaaaaaactctgcaggacgatagcaaagacggcggtcaagacacagacgat
gccggcgccgatagcgaggccaaaccgacaacagtggcaatctga

DBGET integrated database retrieval system