KEGG   Corynebacterium pseudotuberculosis Ft_2193/67: CPTC_01775Help
Entry
CPTC_01775        CDS       T03484                                 

Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
cpsf  Corynebacterium pseudotuberculosis Ft_2193/67
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpsf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPTC_01775
   00520 Amino sugar and nucleotide sugar metabolism
    CPTC_01775
Enzymes [BR:cpsf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CPTC_01775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1856852..1857604
Genome map
AA seq 250 aa AA seqDB search
MTRIGFGIDVGGSGIKGARVDLDTGDFVGDRIKILTPKPATPEAVAQTISRIVAEAEWEG
PVGITLPSVIRNQVALSAANIDQSWINVDVQKLFTKTLGGRNIAVLNDADAAGIAEVAFG
EDQARRGSAILLTLGTGIGSAFFINGVLFPNTELGHMIVEGKEAEHLASSAAKDRDELSY
SKWAKRVSKVLSEYERLFWPDVFIVGGGISRKADKWVPKLTIDTPVIPAKLRNTAGIVGA
AMAADQNIRP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacacgaattggctttggcattgatgttggcggatctgggattaaaggtgcccgcgtt
gatctggataccggtgattttgtcggagatcggatcaaaattttaacccccaagcctgcc
acccccgaagcggtcgcccaaacgatttctcgcattgttgcagaggccgaatgggaagga
cccgtcggaataacgctgccttccgtaatccggaatcaagtagcactttctgccgccaac
attgaccaatcatggatcaatgttgatgttcaaaaattatttaccaagaccctgggcggg
cgtaacatcgcagtgcttaacgacgccgatgcggcgggcatcgccgaggtagccttcgga
gaagatcaagctcgacgtggttccgccattttgctcactctaggcactgggatcggttcc
gctttctttatcaacggggtcttattccccaacaccgagttagggcacatgatcgtagag
ggaaaggaagccgagcatctagcttcatctgcagcaaaagatcgcgatgagttgagctat
tccaaatgggccaagcgcgtttctaaagtcctcagcgaatacgaacgacttttttggcca
gacgtttttatcgtaggcggtggtatctcacgcaaagctgataaatgggtacccaaactc
actatcgatacgcccgtcatacctgcaaaactacgtaataccgcaggtatcgtaggagca
gcaatggcggcagaccaaaatatcaggccttag

DBGET integrated database retrieval system