KEGG   Chlamydia psittaci MN: B599_0373Help
Entry
B599_0373         CDS       T02311                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cpsi  Chlamydia psittaci MN
Brite
Enzymes [BR:cpsi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     B599_0373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_N Sod_Fe_C Imm3
Motif
Other DBs
NCBI-ProteinID: AFS21511
LinkDB All DBs
Position
393897..394514
Genome map
AA seq 205 aa AA seqDB search
MTFVPYTLPPLPYDYSALEPVISAEIMHLHHQKHHQGYINNLNEALKKLDLADTQQDLTR
LIALEPTLRFNGGGHINHSLFWEMLAPIGQGGGVPPKHGLLKLIEKFWGTFDNFLKEFIK
FAAPIQGSGWAWLAFCPEKQELMLHATANQDPLEATTGKVPLLGVDVWEHAYYLQYKNVR
LDYLKAIPQVINWGYIEKRFSEITN
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacctttgttccctatactttgcccccattgccctatgattattctgctctagagcca
gtaattagtgctgagattatgcatctacatcatcaaaagcatcatcaaggttatataaat
aatttgaatgaggccttgaagaagttagatctggctgatacacaacaagaccttacgcga
ttgattgctttggagcctactctacgatttaatggtgggggacatattaaccactcccta
ttttgggaaatgctcgccccgataggtcaaggcggaggggtccctccaaagcacggctta
ctgaagctgattgagaaattctggggaacttttgacaactttttaaaagaatttattaaa
tttgccgctccgattcaggggtctggatgggcttggctagctttttgtcccgaaaaacag
gagcttatgctacacgcaacagcaaaccaggatcctctagaagccaccactggtaaggtg
cctcttctcggagtagatgtctgggagcatgcgtattacctccagtataaaaatgttaga
ttagattatttaaaagcaattcctcaagtaattaattggggatatattgaaaaaagattt
tctgagataactaattaa

DBGET integrated database retrieval system