KEGG   Coniophora puteana: CONPUDRAFT_137217Help
Entry
CONPUDRAFT_137217 CDS       T03134                                 

Definition
(RefSeq) arginase deacetylase
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
cput  Coniophora puteana
Brite
Enzymes [BR:cput01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CONPUDRAFT_137217
Chromosome and associated proteins [BR:cput03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     CONPUDRAFT_137217
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 19200992
NCBI-ProteinID: XP_007768557
JGI: Conpu1_137217
LinkDB All DBs
Position
Unknown
AA seq 630 aa AA seqDB search
MISHPSATRNTTVYLQDACLLHRYIRSRDTSGVVERPQRVRAVKVGLAAALARLEGATAR
QLGHENASRSEPGRLSGNAVVEAKAGASSLLSASEPDDLASALGRLNLAKDDTSAIAPGI
RVPGVNIVKSTATVDILDHAAVKYIHGDIEGDVYLENIKEWARTSKEKIVETGREIPEGY
PPLDLYLCPESVDAMQGAIGAVCEAVDDVLSGSTGDPRSDHAFVAVRPPGHHCGEDTPAG
FCFVNNVAIGAAHAHLKHGINRIVILDIDLHHGNGTQSIVWQINEESYRQALESEQAPGT
SQNAGPRIYYGSLHDVLSFPCEDGKPELVQAASVSIHGSHGQHIENIHLQAYESDQHFWG
TLYSSKYRRLLSKAEEFLNNTGGPGDDVIYFISCGFDACEHEYESMSRHGRKVPTSFYHR
FTREICASAERYARGRVISVLEGGYSDRALESGAMAHLCGLVDPSAGAIDEDWWSVDNLV
KLEKATKPRKGGRQSISTFASEPWLSRASEILAFMEPTSSSSSKKAWMHPSSSSRSLRDR
KKPDSSVSSTTSPAASPRGKSAAKKAPKASRPLSDKESSPTTGSAPDQSWSSSSSVSEGD
VKQEVKVEDGAPSKKLPKVILRVRPPADAP
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgatttctcacccgtcggccacgcgtaacacgactgtttatctccaagacgcatgtctt
ctccaccgttatatccgctcgcgcgacacctcaggcgtcgtggaacgcccccaacgcgtg
cgtgctgtcaaggtcggcctcgcggcagcgcttgctcgtctggagggtgcaacggcgcgt
cagcttggacacgagaatgcctcacgttccgaacccggcaggctttctgggaacgctgtg
gtagaggctaaagcaggcgcctcaagtttgctatccgcgtctgaaccggacgacctcgcg
tccgcgctgggccgattgaatctggcaaaggacgacacgagcgcgattgcccccgggata
cgtgtgccaggggtaaatatcgtcaaaagtaccgctaccgtagacatcctcgaccacgct
gctgtcaaatacatacatggcgacattgaaggtgacgtttatctcgaaaatatcaaggag
tgggcacgcacaagtaaagaaaagatcgtggagaccggtcgcgagatacccgaaggatac
ccaccgctggatctctatctctgtcccgaatccgtcgacgcgatgcaaggcgctatcggt
gctgtttgtgaggctgtggatgatgtcttgtctggatcaactggagatccgcgttcagac
cacgcgttcgtcgccgtccgaccaccagggcaccattgtggagaggatacaccggctggc
ttctgcttcgtcaacaacgtcgcgattggcgcggctcatgcacacctcaaacacggcata
aatcgaatcgtcattctggacatcgacttgcaccacggcaacggcacgcagtccatcgtg
tggcagataaacgaagaatcgtatagacaggctcttgagtctgagcaagcgccggggact
tctcaaaatgccggtccccgtatctactacggatcattgcatgacgttctatcctttcct
tgcgaggacgggaagccagaactcgtgcaagctgcgtcggtctccatccacggctcacat
ggacaacacatcgagaacattcacctccaagcctacgaatcggaccaacacttctgggga
accttatacagctcgaagtatcggaggcttctctcaaaagctgaagagtttctcaacaac
acgggtggtccaggcgacgatgttatctactttatcagctgtggcttcgacgcctgcgaa
cacgagtacgaatcgatgtctcggcatggtcgcaaggtgccgacatcgttctaccaccgc
ttcacacgcgagatatgcgcgtccgccgagcgctacgcgcgcggaagagttattagtgtt
cttgagggcggctacagtgatagagccctcgaaagcggtgcgatggcccatctttgcggg
ctcgtcgatccaagtgccggcgcaattgacgaggactggtggagcgttgacaacctagtt
aagctcgagaaagccacaaaacctcgcaaaggaggtcgccagtctatcagcacgtttgcc
tcagaaccatggctcagccgagcgtcagagattcttgcgttcatggagcctacatcgtct
tcgtcctcaaagaaggcttggatgcatcccagctccagctctaggagtctgcgggaccgc
aagaaaccagattccagcgtcagctccacgacttctccggctgcatcgccaaggggcaag
agtgctgccaagaaggcacccaaggccagtcggccgctctcggacaaggaatcgtcacct
accactgggtcagccccggaccagtcatggtcttctagtagcagtgtttcagaaggagac
gttaagcaggaggtcaaggtagaggacggagcgccctcaaagaagcttccgaaggtgata
ttgcgtgtgcgacccccggcggatgcgccatga

DBGET integrated database retrieval system