KEGG   Coniophora puteana: CONPUDRAFT_61355Help
Entry
CONPUDRAFT_61355  CDS       T03134                                 

Definition
(RefSeq) glycosyltransferase family 3 protein
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
cput  Coniophora puteana
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cput00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CONPUDRAFT_61355
Enzymes [BR:cput01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CONPUDRAFT_61355
Glycosyltransferases [BR:cput01003]
 Polysaccharide
  Storage polysaccharide
   CONPUDRAFT_61355
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
Unknown
AA seq 756 aa AA seqDB search
MAETTGSEAASAAFTTTTIPVPTSTQRDVHNPLLFECAWEVANKVGGIYTVIKTKIPVTV
QEYGDRYTLIGPLMYKTAPMEVEAQEPHDPHLAATLDSMRAQGVKMLYGRWLVEGAPRVL
LFDTGSVHYRLDEWKGDLWNLAGIPSPPNDNETNETIILGYLVAWFLGEYASRQLSTAII
AHFHEWQAGLAIPLCRKRHIDVTTVFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKR
GIYHRYCIERAATHCADVFTTVSHITAFESEHLLKRKPDGVLPNGLNVVKFQAIHEFQNL
HATSKAKINEFVRGHFYGHYDFDLENTLYMFTAGRYEYRNKGVDMFIESLARLNYKLQRS
GSKTTVVAFIIMPAATQSYTIEALKGQAVMKQLRDTVTEIQNRIGARLFDHAARFHGENK
DHVAPTDLLSSEDQILLKRRIFALKRNSLPPVVTHNMVDDSNDPILNQVRRVKLFNHSHD
RVKVVFHPDFLNSNNPILGLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNL
SGFGCFMQDLIDRPEDEGCYIVDRRAASVEQSVNQLSDHMFTFCNKTRRQRINQRNRVER
LSPLLDWKNLGIEYSKARQLALRRAYPDAFYGPGGEALDEDEFEMPGSGLDRGNLMSMPA
SPKLRGMATPGDLGTLTEEMQKLETSDYRGGYNWPGSTADDEEDGYPFPLVMKVRSRASS
VMSGASTPGGGAFRSLSEGDLQKADEALSQVNGATS
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaacaactggctcagaggcagcgtccgccgcattcaccaccaccaccatcccc
gtccccacatccacccagcgcgacgtgcacaatccactcctcttcgagtgcgcatgggag
gtcgcaaacaaggtcggcggcatctacaccgtcatcaagacaaagatccccgtcaccgtc
caagagtacggcgaccggtacaccctcatcggcccactcatgtacaagaccgcccccatg
gaggtcgaggcccaggagccccacgacccccacctcgccgccaccctcgacagcatgcgc
gcccagggcgtcaagatgctctacggccgctggctcgtcgagggcgccccgcgcgtgctg
ctgttcgacaccggctcggtccactacagactcgacgaatggaagggcgatctctggaac
ctcgccggtatcccaagcccaccgaacgataacgagaccaacgagaccatcatcctcggc
tacctcgtcgcctggttcctcggagagtacgcctcgcgccagctctctaccgccatcatc
gcccacttccacgagtggcaggccggactcgccatccccctctgccgcaagcgccacatc
gacgtcacgaccgtcttcaccacacacgcgacgctcctcggccgctacctctgcgccggc
tctgtcgacttctacaacaacctgcagtactttgacgtcgaccacgaggcgggcaagcgc
ggcatctaccaccgctactgcatcgagcgcgccgccacccattgcgccgacgtcttcacc
accgtctcgcacatcaccgccttcgagtccgagcacctcctcaagcgcaaacccgacggc
gtgctccccaacggcctcaacgtcgtcaagttccaggcgatccacgagttccagaacctg
cacgcgacgtccaaggccaagatcaacgagttcgtccgcggtcatttctatgggcactat
gactttgacctcgagaatacgctctatatgttcaccgcaggccggtacgaataccgcaac
aagggtgtcgacatgttcatcgagtccctcgcccgcctcaactacaagctgcaacggtcc
ggctcgaaaacgaccgtcgttgcgttcatcatcatgcccgcggcaacgcagtcgtacacc
atcgaggcgctcaagggccaggcggtcatgaagcagctccgcgacacggtgaccgagatc
cagaaccggatcggcgcacgcctctttgaccacgccgcgcgcttccacggcgaaaacaag
gaccacgtcgcgccgacggacctgctctcgtccgaggaccagatcctgctgaagcggcgc
atctttgcgctgaagcgcaactcactcccgcccgtcgtgacgcacaacatggtggacgac
tccaacgacccgatcctgaaccaggtacggcgggtgaagctgttcaaccactcgcacgac
cgcgtcaaggtcgtgttccaccccgactttctgaactcgaacaacccgatcctggggctc
gactatgaggagtttgtgcgcgggtgccatcttggcgtgttcccgtcgtactatgagccg
tggggctacacgcctgccgagtgtacggtgatgggcatcccgtcggtgacaacgaacctg
tccggctttggctgcttcatgcaagacctgatcgaccgccccgaagacgaaggatgctac
atcgtcgaccgccgtgcggcctcggtcgaacaatctgtcaaccagctgtccgaccacatg
ttcaccttctgcaacaagacgcggcggcagcggatcaaccagcgcaaccgggtcgagcgg
ctctcacccttgctcgactggaagaacctggggatcgagtactccaaggcgcggcagctc
gcgctgcggcgggcgtacccggacgcgttctacggcccgggcggggaggcgctggacgag
gacgagttcgagatgcccggttccgggctggacaggggcaacctgatgtcgatgcccgcg
agcccgaagctgcgcgggatggcgacgcccggggaccttgggacgctcaccgaggagatg
cagaaactggagacgagcgattatcggggtggatacaattggcccggatccacagctgat
gacgaggaagacgggtaccctttcccgcttgtgatgaaggtgcggtcgcgggcgagctct
gtgatgtctggagcgagcacgccgggtggaggagcgttcaggagtctgagcgagggagac
ctgcaaaaggcggacgaggctctgagtcaagtgaatggggcaacgtcataa

DBGET integrated database retrieval system