KEGG   Coccidioides posadasii: CPC735_048820Help
Entry
CPC735_048820     CDS       T01332                                 

Definition
(RefSeq) Mn-superoxide dismutase, putative
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cpw  Coccidioides posadasii
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    CPC735_048820
Enzymes [BR:cpw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CPC735_048820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 235 aa AA seqDB search
MATTALRSSLPISALRAGISTVRASRAGLSGIAGSRFFAAKATLPDLPYDYGALEPSISG
RIMELHHKKHHQTYVNSYNDAVQKLAEAQDKLDIQSQVSLQFLTNFHGGGHANHSLFWEN
LAPRSNGGGEPPSGPLAKAIDDKYGSLEEFKKKFNAALAGIQGSGWGWLVKDKQTGDIMI
KTYANQDPVVGQFSPLLGIDAWEHAYYLQYENRKAEYFSAIWDVINWKTVEKRFA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaccgctctccgctcctcgctgcccatcagcgctctgcgtgccggcatctcc
acagtccgtgccagtagagctggtctctcagggatcgctggctctcgcttcttcgctgcg
aaggccacacttcctgatctgccctatgactatggggctcttgaaccctccatctccggc
agaatcatggagctccaccacaagaaacaccatcaaacctatgtgaactcgtacaacgac
gccgtccaaaagcttgccgaagcccaagataaattagacatccagtcccaggtctcattg
cagttcttgaccaacttccatggcggtggacacgccaaccactccctcttctgggagaac
cttgccccacgcagtaacggaggcggcgagccaccaagcggtccgcttgcaaaggctatt
gacgacaaatatggcagcttggaagagttcaagaagaagttcaacgcggctctggcagga
atccaaggaagcggctggggctggctggtcaaggataagcaaactggagatatcatgatc
aagacctatgctaaccaagatcctgttgtcggacaattctcccctcttctaggaatcgat
gcctgggagcacgcatactaccttcaatacgagaaccgcaaggcggaatatttcagtgcc
atctgggatgttatcaactggaagacagttgaaaagagatttgcctaa

DBGET integrated database retrieval system