KEGG   Lachnoclostridium phytofermentans: Cphy_1644Help
Entry
Cphy_1644         CDS       T00619                                 

Definition
(GenBank) D-alanine--D-alanine ligase domain protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
cpy00473  D-Alanine metabolism
cpy00550  Peptidoglycan biosynthesis
cpy01100  Metabolic pathways
cpy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Cphy_1644
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cphy_1644
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Cphy_1644
Enzymes [BR:cpy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Cphy_1644
Peptidoglycan biosynthesis and degradation proteins [BR:cpy01011]
 Precursor biosynthesis
  Amino acid ligase
   Cphy_1644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_4 GARS_A RimK CPSase_L_D2 TTL ATPgrasp_Ter ATPgrasp_ST Dala_Dala_lig_N
Motif
Other DBs
NCBI-ProteinID: ABX42016
UniProt: A9KRE2
LinkDB All DBs
Position
complement(2025880..2026923)
Genome map
AA seq 347 aa AA seqDB search
MENDANGSLGDEADPYSKLRVGITYNLKKGIRTEVIDAEAEYDSIDTVLAIKNALECDNC
HIELMEADTDLPKRLKETPVDIVFNIAEGLKGRGREAEVPAVLNMFNIPFTGSDETTLCL
ALDKALCKRVLSTYRIRTPKYRVFTKDDNRLNTNFSFPCIVKPNAEGSSKGISDICIATN
KEELKTLVTDNIKAYGQDMLVEEYIDGREFTVGVLGNGDDVHVFSPMEIIYLKKNKFNIY
SFNVKQDYKKLIRYECPSKLDPDIEEEMVFMAKKIFKVLSCHDFSRIDFRLNSEGKPYFI
EINPLPGLAPGYSDFPMLAEFCGMDYVTLVRSILRNALHRNGLPFQI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgatgcaaatggcagcttgggagatgaagctgacccttattccaaactacgg
gttggaataacttataatttaaagaaagggattcgtaccgaagtcattgatgcagaagct
gaatatgacagcatcgatacggttctagccatcaaaaacgctttagaatgtgacaattgc
cacatagaattaatggaggcagatactgatttgcccaaacggctgaaagaaacgccggtc
gatattgtgtttaacatagcagaagggttaaaaggaagaggccgagaagctgaggttcct
gcagtccttaatatgtttaacattccatttaccggttcggacgaaacaaccctatgcctt
gcactagataaggcactttgtaaacgagttttatccacctatcgcatcagaacaccgaaa
taccgagtgtttaccaaagacgataatcgccttaatactaacttttcttttccatgcatc
gtaaagccaaatgcagaaggttccagtaaaggtatctccgatatttgtattgctacgaat
aaggaagagttgaaaacactcgtaacagataatatcaaggcttatggccaggatatgtta
gtggaagaatacatcgatggtagagaatttactgttggcgtacttggaaatggcgatgat
gttcatgtattctcccctatggaaattatctatctcaagaaaaataaatttaatatttac
agctttaatgttaagcaagattataaaaaattaattcgctatgaatgcccatcgaaactt
gatcctgatatcgaagaggaaatggttttcatggctaaaaagatatttaaagtcctaagt
tgccacgatttttccagaatcgattttaggctaaattcagagggaaaaccttattttatc
gaaataaatcctctccctggtttggctcctggttatagcgactttccaatgctggctgag
ttttgtggaatggactatgttacattagttcgcagtattctaagaaacgcactccatcgg
aatggtcttccatttcaaatctaa

DBGET integrated database retrieval system