KEGG   Corynebacterium pseudotuberculosis PAT10: CpPAT10_1893Help
Entry
CpPAT10_1893      CDS       T01879                                 

Gene name
adhA
Definition
(GenBank) Alcohol dehydrogenase GroES-like protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cpz  Corynebacterium pseudotuberculosis PAT10
Pathway
cpz00010  Glycolysis / Gluconeogenesis
cpz00071  Fatty acid degradation
cpz00350  Tyrosine metabolism
cpz00625  Chloroalkane and chloroalkene degradation
cpz00626  Naphthalene degradation
cpz01100  Metabolic pathways
cpz01110  Biosynthesis of secondary metabolites
cpz01120  Microbial metabolism in diverse environments
cpz01130  Biosynthesis of antibiotics
cpz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cpz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpPAT10_1893 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    CpPAT10_1893 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CpPAT10_1893 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CpPAT10_1893 (adhA)
   00626 Naphthalene degradation
    CpPAT10_1893 (adhA)
Enzymes [BR:cpz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CpPAT10_1893 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C adh_short Methyltransf_25 TrkA_N Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AEK93211
LinkDB All DBs
Position
complement(2071321..2072358)
Genome map
AA seq 345 aa AA seqDB search
MKTDFPEAFTAAVVDNFGPELNIHDVVLPEPGPNQALVKLVASGICHTDLHAAEGDWPVK
PEPPFVPGHEGVGEVVKLGPGHHRVQLGDMVGNVWLWSACGECEYCRTGRETLCNDAEYG
GYTVDGSFGEYMLVDTRYCARIPEGSDPVEVAPILCAGVTVYKGLKETECKPGQYMVISG
IGGLGHIAVQYAVAMGMRVIAVDIADEKLELARKHGAEFAVNALKEDPVESINAFTSGGA
HGVLVTAVHPQAFGQAIGMARKGGTIVFNGLPPGEFPAPIFEIVFKGLTIRGSLVGTRQD
LEEALDFYARGMIKPTVTECKLGDVNSVFADMHKGTVDGRMAIRY
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaccgatttccctgaggccttcaccgccgctgtagttgacaactttggccctgaa
ctcaatatccacgatgttgttttgcccgagccgggacctaatcaggcattggtaaagctg
gtggcctctggtatttgccatacagatcttcatgcggcggaaggggactggccggtaaaa
ccggaaccgccttttgtccccgggcatgaaggcgtgggggaagttgtgaaattgggaccc
ggccatcatcgcgtgcaacttggagacatggtgggcaacgtttggctttggtccgcctgt
ggggagtgcgagtactgccgcaccggacgtgaaaccctttgcaatgacgccgaatatggc
ggctatacggtcgacggctcttttggtgaatacatgctggtagatacccgctactgtgcg
cgtattccagaaggctccgatccagttgaagtggcccccatcttgtgtgccggcgtgacc
gtgtacaaaggcctcaaagaaaccgagtgtaagccgggccagtacatggtgatttccggc
atcggtggcctagggcatatcgctgtgcagtatgcggtggctatgggaatgcgagtgatc
gctgtggatattgcagatgagaagctcgagctggcgcgtaagcacggtgcagaatttgca
gtcaatgcgttgaaggaagacccggttgagtcgatcaacgcatttacctcaggtggtgcg
catggcgttttggtcactgccgtgcacccgcaggcgtttggacaagccatcgggatggcc
agaaaaggcggaaccatcgtatttaatgggcttcctccaggagagttcccggcaccgatt
tttgagattgtgttcaaggggttaactattcgcggttcattggtgggaacgcgccaggac
ctagaagaagccctggatttctatgcacgcggaatgatcaaaccgaccgttacggaatgc
aagcttggcgacgtcaacagtgtcttcgccgatatgcataaaggcacggttgatggtcgc
atggctattaggtattaa

DBGET integrated database retrieval system