KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ007079Help
Entry
CpipJ_CPIJ007079  CDS       T01079                                 

Definition
(RefSeq) trypsin-1
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    CpipJ_CPIJ007079
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     CpipJ_CPIJ007079
Peptidases [BR:cqu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   CpipJ_CPIJ007079
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CpipJ_CPIJ007079
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
VectorBase: 
UniProt: 
LinkDB All DBs
AA seq 274 aa AA seqDB search
MFNSLVLCLVLGRSVLLVGAVLGGESDLLPRPHYGTDFGSILPRGYRIVGGFEISIADAP
HQVSLQSRGSHICGGSIISPKWILTAAHCTDGASVSNLRIRAGSSKHASGGSVISIKRIV
QHSSYNRNTIDYDYSLLELKSAISLGSNAAVIPLPAQNETVQDGTLCEVTGWGNTQSVSE
SRANLRAAYVPAYNQNQCNSAYARYGGVTGRMLCAGYQAGGKDACQGDSGGPLVANGKLV
GVVSWGLGCAQANYPGVYSRVAAARDWIRSNSGV
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgttcaactcgttggttctgtgcttggttcttggacggagtgttctgctagttggagcc
gttctaggcggcgaaagcgacctcctacctcgaccacactacggaaccgacttcggatct
attcttccaagaggataccgcatcgtgggaggtttcgagatcagcatcgccgacgctccc
caccaagtttccctccaatcccgcggttcccacatctgcggtggatccatcatctcgccc
aagtggatcctcacggccgctcactgtaccgacggagcttccgtgtcgaacctccgcatc
cgggcgggatcctccaagcacgcctccggtggctcggtcatctccattaagcggatcgtg
cagcattcgtcgtacaaccgcaacacgatcgactacgactactccctgctggagctgaag
agtgccatctcgctgggaagcaacgcagcggttattccgttgccagcgcagaacgaaacg
gtccaggacggaacgctgtgtgaggtgaccggatggggtaacacgcagagcgtcagtgag
tcccgggcgaatctgcgagccgcgtacgttccggcgtacaatcagaaccagtgtaactcg
gcgtatgctcggtatggaggggtaaccggtcggatgctctgcgctggatatcaagctgga
ggtaaggacgcctgccagggtgattccggaggtccgttggttgccaacgggaagctcgtt
ggagttgtttcgtggggtttgggctgtgctcaggccaactatcctggtgtgtactcgagg
gtggctgcggcacgtgactggattcgcagcaatagtggagtttaa

DBGET integrated database retrieval system