KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ008729Help
Entry
CpipJ_CPIJ008729  CDS       T01079                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial
  KO
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CpipJ_CPIJ008729
   00650 Butanoate metabolism
    CpipJ_CPIJ008729
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CpipJ_CPIJ008729
   00280 Valine, leucine and isoleucine degradation
    CpipJ_CPIJ008729
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CpipJ_CPIJ008729
Enzymes [BR:cqu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CpipJ_CPIJ008729
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CpipJ_CPIJ008729
Amino acid related enzymes [BR:cqu01007]
 Aminotransferase (transaminase)
  Class III
   CpipJ_CPIJ008729
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
VectorBase: 
UniProt: 
LinkDB All DBs
AA seq 387 aa AA seqDB search
MIDGLRNLLSALVNRPALGVFPGEDWPAKLQNVLMSVAPTGLDHVTTMMCGSCSNENAFK
NIFIWYQSQLRGKAPFSEKEIASSMVNQAPGAPKLSILSFHGAFHGRTLGCLSTTHSKYI
HKIDIPSFDWPIASFPKYRYPLEENVRENAQEDARCLAEVEGLIEAYAKKGIPVAGIIVE
PIQSEGGDNEASPEFFQNLQKIAKRHGSALLIDEVQTGGGPTGKLWCHEHFNLDSPPDVV
TFSKKMQLGGYYHAAHMKPAQPYRVFNTWMGDPGKLLLLESILKVIKQESLLKNVEKTGA
KLKAGLLQAQNEFPTLLNSARGRGTFLAINCASTKLRDDIVAALKQKGVLSGGCGEISIR
FRPALIFQERHVDIFLDKFRQVLKELK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgattgatggtttgcgaaatttgctttcagctctcgtcaaccgccctgctctcggtgtc
ttcccgggcgaagattggcccgccaagttgcagaatgtgctgatgtcggtggcgcccacg
gggctggaccacgtgaccacgatgatgtgcggatcgtgctcgaacgagaacgccttcaag
aacatcttcatctggtaccagagccagctgcggggcaaggcaccgttttccgagaaggaa
atcgcgtccagcatggtcaatcaggcgccgggtgcgcccaagctgagcattctgagcttc
cacggagcgttccacggtcgcacgctgggttgtctgtcgacgacgcactccaagtacatc
cacaagattgacattccgtcgttcgactggccaattgcgtcgttccccaagtatcggtac
ccgctggaggagaatgtccgcgagaatgcccaggaagatgcgcgttgtttggccgaggtc
gagggactgattgaggcttacgccaagaagggaattcccgtggctggaatcatcgttgag
ccgatccagagcgaaggtggtgacaacgaggcgtcgccggaattcttccagaatctgcag
aaaatcgccaagcgtcacggaagtgccctgctgatcgatgaagttcaaaccggaggtggc
ccaactggcaagctgtggtgccacgagcacttcaacctggacagcccaccggatgtggtg
acgttcagcaagaaaatgcaactcggcggttattaccacgctgcgcacatgaagccggct
cagccgtaccgcgtgttcaacacctggatgggagacccaggcaagctgctgctcctggag
tcgattctcaaggtcatcaagcaggaatcccttctgaagaacgtcgaaaagaccggtgcc
aaactgaaggctggactgcttcaagctcaaaatgaattcccgacactgcttaactctgcc
cgcggccggggcaccttcctcgccatcaactgtgccagcaccaaactccgagacgacatc
gtcgcagctctcaagcagaagggtgttctctccggaggctgtggcgagatcagcatccgc
ttccggccggcactgatcttccaggagcgccacgtggacatctttctggacaagttccgc
caggtgctgaaggagctcaaataa

DBGET integrated database retrieval system