KEGG   Capsella rubella: CARUB_v10014517mgHelp
Entry
CARUB_v10014517mg CDS       T02984                                 

Definition
(RefSeq) hypothetical protein
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
crb  Capsella rubella
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CARUB_v10014517mg
Enzymes [BR:crb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CARUB_v10014517mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 238 aa AA seqDB search
MATLKASILLKTLDSDISGDVLSDLGRRGSGAVHVIMGPMFSGKSTSLLRRVKSEISAGR
SVAMLKSSKDTRYAKDSVVTHDGIGFPCWALPDLMSFPHKFGQDAYNKLDVIGIDEAQFF
GDLYEFCCKVADEDGKTVIVAGLDGDYLRRSFGAVLDVIPIADSVTKLTARCEVCGQKAF
FTLRKTCDTRTELIGGADVYMPVCRKHYITNHIVIKASKKVLEDSDKARAESCVAAII
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggccactctcaaagcttcgattttgctcaaaaccctcgacagtgacatctccggagat
gttctttccgatctgggacgtcgtggatccggtgctgttcatgttattatgggtcctatg
ttttctgggaaatcgacctctcttctccgccgagtcaagtcagagatcagcgccgggaga
agtgttgcgatgctgaaatcgagtaaggatacgagatacgccaaagattcggtggtgaca
catgatggaattggattcccttgctgggctcttccagatctcatgtcatttcctcataaa
ttcggacaagatgcttataacaagcttgatgtgattggtattgacgaggctcaatttttt
ggagatctttatgagttttgttgcaaagtcgctgatgaagatggcaaaacagtgattgtt
gcaggcctagacggtgactatttaagaaggagctttggtgctgttcttgatgttatacca
atagctgactctgtgacaaagctaacggcaaggtgtgaggtttgtggacagaaagctttc
ttcactttaagaaagacttgtgataccagaaccgagcttattggtggagctgatgtctat
atgcctgtttgtcgcaagcattacatcactaatcacattgtcattaaagcatctaagaaa
gtgttggaagattctgacaaggccagagctgaatcctgtgttgctgctattatctaa

DBGET integrated database retrieval system