KEGG   Capsella rubella: CARUB_v10015630mgHelp
Entry
CARUB_v10015630mg CDS       T02984                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
crb  Capsella rubella
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:crb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CARUB_v10015630mg
   00051 Fructose and mannose metabolism
    CARUB_v10015630mg
   00052 Galactose metabolism
    CARUB_v10015630mg
   00500 Starch and sucrose metabolism
    CARUB_v10015630mg
   00520 Amino sugar and nucleotide sugar metabolism
    CARUB_v10015630mg
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CARUB_v10015630mg
Enzymes [BR:crb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CARUB_v10015630mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 504 aa AA seqDB search
MGKVAVATTVVCSVAVCAAAALIVRRRMQSSGKWARVIEILKAFEEDCATPIAKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKQDR
VVKREFKEESIPPHLMTGKSDELFDFIAEVLAKFVATEGEDFHLPPGKQRELGFTFSFPV
KQTSLSSGTLINWTKGFSIEDTVGQDVVGELVKAMERVGLDMRVAALVNDTIGTLAGGRY
TNPDVVVAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEYDH
SLDFESLNPGEQILEKIISGMYLGEILRRVLLKMAEEAAFFGDVVPPKLRIPFIIRTPNM
SAMHSDTSPDLKVVGNKLKDILEVPTSSLKMRKVVISLCNIIASRGARLSAAGIYGILKK
IGRDASKDGETQKSVIAMDGGLFEHYTQFSEAMKSSLKELLGDEVAESVEVILSNDGSGV
GAALLAASHSQYLEPEEDSETSQS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagtggctgttgcaacgacggttgtgtgctctgtggcggtctgtgcggcggct
gctttgattgtacggcggcgaatgcaaagctcaggtaaatgggcacgcgtgattgagatc
ttgaaagctttcgaagaagactgtgccacgccaattgcgaaattgagacaagtggctgat
gctatgactgttgagatgcacgctggtcttgcatctgaaggtggaagcaagcttaagatg
cttattagctatgttgataatcttccttctggggatgaaactggtttcttttatgcattg
gatctaggcggaacaaatttccgtgtaatgcgtgtgcttcttggtgggaagcaagaccgt
gttgtgaaacgagagtttaaagaagagtcaattcctcctcatctgatgaccggcaaatca
gacgaattattcgattttatcgctgaagttcttgcaaagtttgtcgctacagaaggcgag
gactttcatctccctcccggtaaacaaagggaattaggtttcactttctcatttccggtt
aagcagacatctttgtcctctggcactctcatcaactggacaaagggcttttccattgaa
gatacagttggtcaagatgttgttggagaacttgttaaagctatggaaagagttgggctg
gacatgcgtgttgcagcgcttgttaatgataccattggaacacttgcgggtggtagatac
actaatccggatgttgttgttgctgttattttgggcaccggcacaaatgcagcctatgtt
gaacgtgcacatgcaattcccaaatggcatggtttgcttcccaaatcaggagaaatggtt
atcaacatggagtggggaaacttcaggtcatcgcatcttccattgacagaatacgaccac
tctctagatttcgagagtttgaatcctggtgaacagattcttgagaaaattatttccgga
atgtatttgggagaaatcttgcgtagagttcttctgaagatggccgaagaagctgctttc
tttggcgacgtcgtcccaccaaagctgagaataccattcatcataaggaccccgaacatg
tctgctatgcacagcgacacttctcctgatttgaaggttgtgggaaacaagttgaaggac
atattagaggtccctacgtcttctctgaagatgagaaaagttgtgatcagcctctgtaac
atcatcgcaagccgaggagctcgtttatctgctgcagggatctatggaattctcaagaaa
atcggaagagacgcatcaaaagatggagaaactcagaaatctgtaatagccatggacggt
ggtctattcgagcactacactcagttcagcgaggcaatgaagagttcgttgaaagagttg
cttggagatgaagttgcagagagtgttgaagtgatactatcgaatgatggttcaggtgtt
ggagcagcattactcgctgcttctcattctcagtatctggaacctgaagaagattctgaa
acaagtcaatcttaa

DBGET integrated database retrieval system