KEGG   Capsella rubella: CARUB_v10023499mgHelp
Entry
CARUB_v10023499mg CDS       T02984                                 

Definition
(RefSeq) hypothetical protein
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
crb  Capsella rubella
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:crb00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CARUB_v10023499mg
Enzymes [BR:crb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CARUB_v10023499mg
Chromosome [BR:crb03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     CARUB_v10023499mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 361 aa AA seqDB search
MPTTKKISDRNHLGQVFNKLLNQIGESEEFELPDWLNKGKPTPYIFIRRSIYLTKKVKKR
VEDDGIFCSCSSASPGSSSTVCGSNCHCGMLFSTCSSSCKCGSECNNKPFQQRHVKKLKL
IQTEKCGSGIVAEEEIKPGEFIIEYVGEVIDDKTCEERLWKMKHRGETNFYLCEINRDMV
IDATHKGNKSRYINHSCNPNTQMQKWIIDGETRIGIFATRGIKKGEHLTYDYQFVQFGAD
QDCHCGAVGCRRKLGVKPSKPKVASDEALNLIANEVAQTQPKVHQNGHIHAGKSWKNLSQ
GKICSRNCIGAVIRLSRATSDRCFGLVRHFDEHSRKHSVMFEDGVTEFIDMSREDWEIVT
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccaccaaaaagatttccgacaggaaccacttagggcaagtgttcaacaagcta
ttgaatcagattggagaatctgaagaatttgagttgccagattggttgaacaaagggaaa
cctactccttacatcttcatcaggcgcagtatttacttgacgaagaaagtcaaaaagagg
gttgaagatgatggaatcttctgttcttgctcctctgcgtcccctggctcttcttcaact
gtgtgtggcagtaattgccattgtgggatgctattctcaacctgttcttcaagctgcaag
tgtgggagtgagtgtaacaataagccgttccaacaacgccatgtcaaaaagttgaagtta
attcagacagaaaaatgtggatcagggattgtagccgaagaagaaatcaaaccaggagag
tttatcattgaatatgttggagaagttatagatgataagacttgtgaagaaaggctttgg
aagatgaaacaccgtggcgagacaaacttttatttatgtgagataaacagagatatggtg
attgatgctactcacaagggaaataaatcgagatatatcaatcatagttgcaaccctaat
acgcagatgcagaaatggataattgatggcgagacaagaatcggcatttttgccacgcgt
ggcatcaaaaagggagaacatttgacctatgattatcagtttgttcagtttggtgctgat
caagactgccattgtggagccgtaggttgcagaagaaagcttggggtaaaacctagcaaa
cctaaggtagcctcggatgaagctttgaatctaattgcaaatgaagtggcccagactcag
cccaaggtgcatcaaaatgggcatatacatgcaggaaaatcatggaaaaatcttagtcaa
gggaaaatatgttctcgtaattgcattggtgcagtgattaggttatctcgcgctacgagt
gataggtgttttggccttgttagacattttgatgagcattccagaaagcactcggttatg
ttcgaggatggtgtcaccgagtttatcgatatgtcgagggaagactgggagattgtaact
gtctga

DBGET integrated database retrieval system