KEGG   Capsella rubella: CARUB_v10027582mgHelp
Entry
CARUB_v10027582mg CDS       T02984                                 

Definition
(RefSeq) hypothetical protein
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
crb  Capsella rubella
Brite
Enzymes [BR:crb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CARUB_v10027582mg
Chromosome [BR:crb03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     CARUB_v10027582mg
   HDAC complexes
    Sin3A-HDAC complex
     CARUB_v10027582mg
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    CARUB_v10027582mg
  Chromatin remodeling factors
   NuRD complex
    CARUB_v10027582mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 449 aa AA seqDB search
MEADESGISLPSGPDGRKRRVSYFYEPTIGDYYYGQGHPMKPHRIRMAHSLIVHYQLHRR
LEISRPNLADASDIGRFHSPEYVDFLASVSPESMGDPSSARNLRRFNVGEDCPVFDGLFD
FCRASAGGSIGAAVKLNRQDADIAINWGGGLHHAKKSEASGFCYVNDIVLGILELLKMFR
RVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKFGDFFPGTGHIRDVGAENGKYYALNVPL
NDGMDDESFRSLFRPLIQKVMEVYQPEAVVLQCGADSLSGDRLGCFNLSVKGHADCLRFL
RSYNVPLMVLGGGGYTIRNVARCWCYETAVAVGVEPDNNLPYNEYFEYFGPDYTLHVDPG
PMENLNTPKDMEKIRNTLLEQLSGLMHAPSVQFQHTPPVNRVLEESEEDMETRPKPRIWS
GTAAYDSDSDDDDKPLHGFSGLDGRTMDR
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagacgaaagcggcatctccttgccgtcgggacccgacggtcgtaagcggcga
gttagttacttctatgagcccacgatcggagactactactacggtcaaggccatccgatg
aaacctcaccggatccgtatggctcatagcctaatcgtccactatcaactccaccgtcgt
ttagaaatcagccgccctaacctcgccgacgcctccgatattggccggtttcattctccc
gagtatgttgattttctcgcttccgtttcgcctgaatctatgggcgatccttcctctgca
cgaaaccttaggcgattcaatgtcggcgaggattgtcctgtcttcgacggactttttgat
ttttgccgtgcttcggccgggggttccattggcgccgccgtcaaattgaacaggcaggac
gctgatatcgctatcaattggggcggtgggcttcaccatgctaagaaaagcgaggcctct
gggttttgctatgtaaatgacatcgtgctagggattctggagctgctcaagatgtttagg
cgggttctctacatagatatcgatgtccaccatggagatggagtagaagaagcgttttac
accactgatagagttatgactgtttcttttcacaagtttggggactttttcccaggaact
ggtcacataagagacgttggcgcagagaatgggaaatactacgctcttaatgttccatta
aacgatggtatggacgatgaaagtttccgcagcttgtttagacctcttatccagaaggtt
atggaggtgtatcagccagaagcagttgttcttcagtgtggggctgactccttaagcggt
gatcggttgggttgcttcaacttatcagtcaagggacatgccgattgcctccggttctta
agatcttacaatgttcctctcatggtcttgggtggtggagggtatactattcgaaatgtt
gcccgttgctggtgttatgagactgcagtggcagttggagtagagcccgacaacaacctc
ccatacaatgagtattttgagtatttcggcccagattatacgcttcatgtcgacccaggt
ccaatggagaatttaaacacaccaaaagatatggagaaaataaggaacacattgctggaa
caactttcgggactaatgcacgcacctagtgtgcagtttcagcatacaccaccagtcaat
cgagttttggaagagtcggaagaagatatggagacaagaccaaagcctcgcatctggagt
gggactgcagcttatgattcagacagtgacgatgatgataaacctctacatggtttctca
ggtcttgatggccgaactatggacaggtaa

DBGET integrated database retrieval system