KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_102571Help
Entry
CHLREDRAFT_102571 CDS       T01039                                 

Definition
(RefSeq) predicted protein
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
cre  Chlamydomonas reinhardtii
Pathway
cre00240  Pyrimidine metabolism
cre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CHLREDRAFT_102571
Enzymes [BR:cre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CHLREDRAFT_102571
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_30 AAA_14 AAA_22
Motif
Other DBs
NCBI-GeneID: 5718689
NCBI-ProteinID: XP_001693099
JGI: 102571
UniProt: A8IWF5
LinkDB All DBs
Position
Unknown
AA seq 195 aa AA seqDB search
GTQHEPQHGGVGQLHLIVGPMFAGKTTRLIQRVREAEAAGRRTVVVKSAVDTRYAVDAVV
THDGVRAPCVPLSRLGDLRAALGEAEYAATQVVAIDEAQFIGDLREAVLQATEADGKTVY
VAGLSGDFRRDNFGQISQLLPLADNVEKLSGRCTFCEQQGRRSASHFTLRIAASTQQELV
GGAEAYAPVCREHYV
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
ggcactcagcatgaaccacagcatgggggcgttgggcagctgcaccttatcgtgggaccg
atgttcgccggaaagaccacgcgcctcatccagcgcgtgcgcgaggcggaggcggcgggg
cggcgcacggtggtggtcaagagcgcagtggacacgcgctatgcagtggacgcggtggtg
acacacgacggcgtgcgggcgccctgcgtgccgctgtcgcgcctgggtgacctgagggcg
gcactgggcgaggctgagtacgccgccacacaggtggtggccattgacgaggcgcagttc
attggggacctgcgcgaggcggtgctgcaggcgactgaggcggacggcaagacggtgtac
gtggcggggctgtcgggcgacttccggagagacaactttgggcagatctcccagctgctt
ccgctcgccgacaatgtggagaagctgtctgggcgctgcaccttctgcgagcagcagggc
cgccgcagcgcctcgcacttcacgctgcgcatcgccgccagcacacagcaggagctggtt
ggtggcgctgaggcgtacgcgcccgtgtgccgggagcactacgtg

DBGET integrated database retrieval system