KEGG   Crassostrea gigas (Pacific oyster): 105322748Help
Entry
105322748         CDS       T03920                                 

Definition
(RefSeq) uncharacterized protein LOC105322748 isoform X1
  KO
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:crg00001]
  Amino acid metabolism
   00310 Lysine degradation
    105322748
Enzymes [BR:crg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105322748
Chromosome [BR:crg03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105322748
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 2365 aa AA seqDB search
MNREDPEVTSHVYSSESPHSSTAESSDSDNASSSEKEFSVQGTNFKQGQLKLTISAKQKS
SSSSSSPSYDEGQGSRLNEEDSVFVDTGQSCRTNPEQYVRKSSTRMEHPNDSNEHTSEST
YDAEGPNASNYTEEGSNQSSEGFQNTFQQFVQSSGVEEQVLDEAKISSNGSKDKFSSKCY
VLLDKKSSPLKRHYRKMASKAGSVKDVGNLDKIREKTKSLASRKKNLVVSEATKDDNSES
ECEHTNEIPESECSNLHDNIFDKMMNTALNNISSEADSKSQKKRRPLKANKSKQRPSNCD
IEKESEIPCEINSSKLAADVARNEFIFRNTRSGDESDAMSDRTRPGSVHDQQESFSRLDN
MQSNVSPDSGISLADSPVGNESPISVTLSDINSKVNVGVYTSDICCVQTSEKLDSAETVS
CEMASSCQKQDAMNGGSGVDLQKSNHRHDKEFDMGSPHCDSLVVNTNLGDNILGCCSSSD
TSSSHSPSPKKKSVGRVPKRAEFLRLHKSSTLLTTGKMPVQVDDTISKEDNSFSVPLIPG
PSLQERLAQCPDRVQEEDEPPQPKKRKYTKHKKNSEKVLKKAFDVYEFHEGDKPIKKRSV
GRPPGQGKAKISGGGRGPGRPPGKPTFKKRGPGRPPKVVSAQAAKRGPGRPKGSLNKKTL
LARAGVNHSKGVNNSQKTSTAPGTKKTSSTEVESGLILPENILDQLSQIDANSDVINFSD
ISPSKSSESSLSEAHNNYLQNLSDISPAKSTSSVESSSFSFKPPIYQMRAPSPVPFQKPP
ERRKVGRPRKRPLKPEASLPSTSSDRHGFDQFPTSSVENESEDRELESIIQSVQNSISSQ
FHNPSMLALDDLHESSIEDELNSIEPTFDPVPSVGQQHSAESKLKQVPKIRKPKLHVMMR
KHGNLKSKRGRKKKKYTVTPTEFSGGSFTDKYNAFSSSPKFKLSSAKTLLGFTSKSNILA
SSNFDSDPEDGDENRHFLQKMKQQQKLKKKKEKLINFRSKHRNIVDPLFLNHLEYVIDNF
HLLAISRPEETFIRVKPGEVPLPSIFKLTKINVKSKKKDIRHPFESEKVKRLKTSRSRDF
ALQIMEKKSKMKSFHRKLFSFKEKKFFPSWNHSDDDLGLQQYVPNVPPKKRHKFLSDIPP
TTKNLTGMGAGPVQQPEKRKPGRPRKNPVLKPSSECRSGEVAQRNRQLLTGVKSTSSNLI
TKDGRETSINSQGSINLCESPRIPLPPDNSFVTNSAVPPNSKFSGYQVNSISVQTESCVD
CIQLQCSSKSVHRKRGRKPGSVVLKDHSKVPSGQLSKSFAIKIKEKLLRGRKKKRKVGRP
RTRPLDQDPKVSKIIHRKKSHARLPTSKPFLHQAEGDLMCNNVTPNGDNVNNTIESVIRN
VCSEYEPLPCKEQKKSSVFGVDSDDEDYVPSKRVKKRNHLKSKLPSTSTEASDSDIGNKR
DVTGLPKKKYQKAGLFSDTYKEDPDPKKTPSSGGSSKSREKVVYKKQGSLLPPPIHVGKH
LRERQCDFHLSYDIWWQLINDLLPKREGYEEKYRKIRNNIHVDVKPVCDEAHPCTCKRPY
DPEVKGCGEECLNRMMYTECDISTCPCQEQCLNQRFHKHEWVSGLEVIVTKDRGYGIRTS
DSISNGQFILEYLGEVVSEAEFRRRMTEEYSQERHHYCLNLDSGAVIDGYRMGNIGRYVN
HSCEPNCEMQKWNVNGVYRMGLFALKDISPNMELTYDYNFHSFNVDAQQLCRCGSENCRG
VIGGKTQRVNGLVKEKSKGPGRPPKDKRKSKNRLKKYKEKKSGKDNSATSTMSTVKPMSH
KERFFARTHAIFLLRNIDKQRHIGRKAPEKLDKEEEYVKATGYTKKDVFLSQLTALKTAR
SVKTRRLALAEENTELTQTARLAQVFNSVCRQVMEYKDKDGRDPVSTLALPSKKKHPEYY
TVIENPTDFQIIEKNIFSGAYADLEAFDKDMNTLFKNAERYSGRSSWMGQLVAELRKVYV
TAKAEAAPILEDILGEGSVQSLDRETTETEAVEGLEEEEEEVIRCVCGIFRDEGLMIQCE
KCFIWQHCDCMKVKGEVENYLCELCQPRPVEKEILADPQPDDATEGWTYYMTLMRDEIQI
RVGDCVYVLREVPKPENRIPIDSVKTSYRVISEIGQDKLDIFRIERLWKDENGRNFAFGH
NYYRPHETFHEPSRKFFPNEVFRMPIYEIIPFDAIVGGCCVMDLNTFCKGRPKGTREQDI
FICEYRMDKTAHLFYKISKQPYVINTKSYCFDKYEKRLNPKRTYSPHEVPEQYKRKTAME
ERSQTEIPKRKKTVKEHYQEQKSPKTEEQREMMVKMEEEKRREKRDHIDAITLKLLDLTP
KKQRLDVSYLLDKKRQQKKPHVLDV
NT seq 7098 nt NT seq  +upstreamnt  +downstreamnt
atgaacagagaggacccagaagtgacttcccatgtatatagcagcgaatctcctcactcc
agtacagcagagtcttctgacagcgataacgccagttcatctgaaaaggagttctctgtc
caagggactaattttaaacaagggcagttaaagcttaccatatcagctaaacagaaaagt
tcatcttcttcatcttcccctagttatgacgaaggacagggctccagactaaatgaggaa
gacagtgtatttgttgacacagggcaatcatgtagaaccaatcctgagcagtatgtgaga
aaatcctcaacaaggatggaacatccaaatgattccaacgaacacacaagtgaatccacg
tatgatgctgaaggacccaatgctagtaattatacggaggaagggtcaaatcagtcatct
gaaggatttcagaatacattccaacaatttgtgcagtcatcaggtgtagaagaacaagtg
ttagatgaagccaaaatttcctcaaatgggagtaaagacaaattttcaagtaaatgctat
gtattactggataaaaagagctcaccgttaaaaagacactacagaaagatggcatcaaaa
gcagggagtgttaaggatgtgggaaacttagacaaaataagagagaagaccaaatctttg
gcatcaaggaagaaaaatctggtggtctctgaagcaacaaaagatgacaactctgaaagt
gaatgtgaacatacaaatgaaataccggagtctgaatgttcgaatctccatgacaatatt
tttgataaaatgatgaacactgctctaaacaacatatcatctgaagcagacagtaaatct
caaaagaaacgaaggccactcaaggcaaataaatctaagcaaagaccatcgaattgtgac
atagaaaaagaaagtgaaattccatgtgaaattaattcgtctaaactggctgccgatgtt
gctagaaatgaattcattttcaggaatacgagaagtggagatgaatctgatgctatgtcg
gatcgcacccgtccaggaagtgttcatgatcagcaggaaagtttctctcgcttggacaac
atgcagtccaatgtgtcaccagatagtggcatatctttagcagattcacctgttggaaat
gaatctccaatatctgtgacattgtcggatataaattcaaaagtaaatgtgggggtttac
actagtgacatttgttgtgttcaaacaagtgaaaaactggattctgctgaaactgtgtct
tgtgaaatggcatcttcctgtcaaaaacaagatgccatgaatgggggatcaggggttgat
ttgcaaaaatcaaaccataggcatgataaagagtttgatatgggctctccacactgtgat
agtttagttgtgaatacaaacttgggtgataacattttgggttgttgcagcagtagtgat
acatcctcttctcactcaccgtctccaaaaaagaaaagcgttggccgagtacctaaaaga
gccgagtttctgcgactccataagagcagtacattgttgactacgggtaaaatgccagtt
caggttgatgacacaatttcgaaggaagacaattcgttctctgtgccattaatcccaggc
ccttcactgcaagagaggctggcacagtgtccagatagggttcaagaggaggatgagcca
ccacaaccaaagaagcgtaaatacacaaaacacaagaagaacagtgaaaaggttctcaag
aaggcatttgatgtgtacgagtttcatgagggagataagccaataaagaagcgcagtgta
ggacgacccccaggtcaaggaaaagcaaaaatttctggtggtggaagggggccaggtcga
cccccaggaaagcccaccttcaagaaaaggggccctggtaggccacctaaagtggtttcg
gctcaagctgctaaaagaggaccaggtcggcctaaaggctctctaaataagaagacgctt
ctcgcaagagctggtgtaaatcattctaaaggtgtaaataattctcagaaaacaagcact
gcccctggtacgaaaaaaacttcctcaactgaggttgagtctggtctgattttacctgaa
aatattttggaccaactctctcagattgatgctaactcggatgtaatcaacttttcggac
atatcaccatctaaatcatcagagtcatcactctctgaggctcacaacaactaccttcaa
aatctatcagatatctctccagctaagtccacctccagtgtggaaagttcatctttttct
tttaaacctcctatttatcaaatgagggcaccatcccctgtgccatttcaaaaacctcca
gagaggagaaaggtaggaagaccaaggaaaaggccactgaaacctgaagcatccttgccc
tcaacatcctcagataggcatggatttgatcaatttcctacatctagtgtagaaaatgaa
tctgaggatagagaattggagtccattatccaaagtgttcagaattccatatcttcacag
tttcataaccccagcatgttagctcttgacgacttgcatgagagttccattgaggatgag
ctgaattccatagaaccaacctttgacccagtgccttcagttggacaacagcacagtgct
gagtcaaagctaaaacaggttccaaagattcggaaacctaagttgcatgtcatgatgcgt
aaacatggaaacttgaaaagtaaaagaggtcgcaagaaaaagaagtacacagttaccccc
acagaattctctgggggtagctttactgataaatacaatgcattctcatcctcgcccaaa
ttcaaattatcaagtgctaagacactacttggttttacaagtaagtccaatatcttggcg
tctagtaattttgattctgatccagaagatggggatgaaaataggcattttctacagaaa
atgaaacagcagcaaaaactgaagaaaaagaaagaaaagttgatcaacttcagatccaaa
catagaaacattgttgaccctctatttctgaatcacttggagtatgtgatagacaatttt
caccttttggccatatctcgtcctgaggaaaccttcataagagtgaagcctggagaagtg
ccattaccaagcattttcaaattaaccaaaatcaatgtgaaatctaaaaagaaagacatt
agacatccttttgagtcagaaaaagtgaaaaggttgaaaacttctcgcagtagggacttt
gctttacagatcatggagaaaaaatccaaaatgaagtcatttcataggaaattgtttagt
ttcaaagagaagaaattttttccttcttggaatcactctgacgatgaccttggtttgcag
caatatgtcccaaatgttcccccaaagaaaagacacaagtttttatctgatattccacca
acaacaaaaaatttgacaggcatgggtgcaggaccagttcagcagccagaaaaacgaaaa
ccagggcggcccagaaaaaatccagtattaaaacccagttcagaatgtaggagtggggaa
gtggctcaaagaaacagacagttgttgacaggtgtaaaaagtacctcctcaaaccttatt
accaaagatgggagagaaaccagtataaactctcagggatcaattaatttatgtgaatct
ccaagaattccattgcctccggacaattcttttgtgacaaactcagctgtgccaccaaat
tcaaaatttagtggatatcaggtgaattcaataagtgttcaaacggaatcttgtgtggat
tgtattcagttgcagtgtagttccaaatcggtgcatcggaaacgtgggcgaaaaccggga
agtgttgtgttaaaagaccatagtaaggttccatcagggcagttatccaaatcatttgcg
attaagattaaagaaaaacttcttcggggccggaaaaagaagcggaaagttggacggcct
cgaactagacccttggatcaagatcccaaagtttcaaaaatcattcacagaaaaaaatct
catgctcggctccccaccagcaaaccttttttacaccaggcagaaggggacctaatgtgc
aataatgtgacacccaatggcgacaatgttaacaatacaatcgagtctgtgatacgaaat
gtgtgctcagaatatgaaccattgccctgcaaggaacagaaaaaatcctctgtttttgga
gtggacagtgatgatgaggactatgtgccatccaaacgagtgaaaaagagaaatcattta
aagtctaagcttcccagtacttcaacagaggcctctgattcagatattggcaacaaaaga
gatgtgacaggactaccaaagaaaaagtaccaaaaagctggtctcttctctgatacttac
aaagaagacccagaccccaagaagactccctccagcggtggcagcagcaaaagtcgcgaa
aaggtggtgtataaaaaacagggtagtctattgccaccacccatccatgtgggcaaacac
ctcagagaacgtcagtgtgactttcatctgtcgtacgatatctggtggcaactgatcaat
gatctgttaccaaagagagaaggctatgaggaaaagtacagaaagataagaaacaatatt
cacgttgatgtcaagcctgtttgtgatgaagcacatccgtgtacctgcaagcgaccttat
gacccagaggttaaaggttgtggcgaggaatgcctgaacagaatgatgtacacggagtgt
gatatcagtacttgtccatgtcaagaacagtgtctgaaccagcgcttccacaaacatgag
tgggtgtccggtctggaagtcattgtcaccaaggaccgcggatatgggatcagaacatca
gactccatatctaatggtcagttcatcctggagtacctgggggaggtggtcagtgaggca
gagttccgccgccgcatgacggaggagtactcccaggagcgccaccactactgtctcaat
ctggatagtggggcagtcatcgacggctacaggatgggcaacattggccgatacgtcaac
cactcctgcgaaccaaactgtgaaatgcaaaaatggaatgtgaacggggtgtacagaatg
ggactctttgcactgaaggacatttcacctaacatggagctgacctatgattataacttc
cactccttcaatgtagatgcccagcaactctgcagatgtggaagtgagaattgtagaggg
gtcattggtggcaaaacccagagagtcaacggtcttgtgaaggaaaagtctaaaggacca
gggagaccgcccaaggataagagaaagtccaaaaacaggctgaaaaagtacaaggagaag
aaatcagggaaagataatagtgctacctcgaccatgtctaccgtgaaaccaatgtcgcac
aaggaacgtttctttgctcgcacccatgccatctttctgctacgaaacattgacaaacag
aggcatattggacgtaaagcaccagagaaactggacaaagaagaagagtatgtcaaggca
actgggtacaccaagaaagacgtgttcctgtcacagctgactgccctcaaaacagccaga
tcagtcaaaacaaggcgcctggctttggcagaagaaaacactgagttgacccagacagct
aggctggcgcaagtattcaacagtgtgtgccgtcaagtcatggagtataaagataaggat
ggaagagatccggtctccactttagccctgccctccaagaagaaacacccagagtattac
acagtcatagagaatcccactgacttccagatcatcgagaagaacatcttttctggagca
tacgcagacctagaggccttcgataaggacatgaatacactattcaaaaatgctgagagg
tacagtggtcggtcctcgtggatgggtcagttagtggcggagctccgtaaggtgtacgtc
accgccaaggccgaggcggccccaatacttgaggacattctgggggaggggagtgtgcag
tccctggacagggagacaacagagacagaggcagtcgaaggattagaggaagaggaggag
gaggtgattcgctgtgtgtgcggaatcttcagggatgagggtctgatgattcagtgtgag
aagtgctttatttggcagcattgcgactgtatgaaggtgaaaggggaggtggagaactat
ttgtgtgagctgtgtcagcccagacctgtggaaaaggaaatcttggctgacccccagcca
gatgatgccacagagggatggacttattatatgactttgatgagggacgagattcagata
cgggtgggtgattgtgtgtatgttctacgagaggtgcctaagccagagaaccgcatccct
atcgattcagtcaaaacctcctacagggtcatatctgagatagggcaagacaaactggat
atctttcgcattgaaagattatggaaagatgaaaatggaagaaattttgcctttggacac
aattattacagaccccatgaaacattccatgaaccatccagaaaattctttccaaatgag
gtcttccggatgcctatttatgagatcatcccctttgatgccatcgtgggaggctgctgt
gtgatggacctgaacactttctgtaaaggacgtcccaaaggaacccgcgaacaagacatc
ttcatttgtgaatacagaatggacaaaaccgcgcacctcttctataagatatcaaagcag
ccatatgtcatcaacacaaagtcatactgttttgacaaatacgagaagaggctgaatcca
aagaggacctactcgcctcatgaagtacctgagcaatacaaacgaaagactgcaatggaa
gagcgttcgcaaacagaaatccccaaacggaagaagactgtcaaagagcattaccaggag
cagaaaagtccaaagactgaggaacagagagaaatgatggtcaagatggaggaagagaag
aggagagaaaaaagggatcacatagatgccatcaccctgaaacttctggacctgacccca
aagaagcagaggctggatgtgtcctatctcctggacaagaaacgacagcaaaagaaaccc
cacgtgctcgacgtctga

DBGET integrated database retrieval system